! / 1365813253 0 0 0 16170 `  B~HO~U\vbiovz|jjjbbRbV>Vn nn%,n29Z?FJLSJY`2fm2sz* znbbVN:"")/6 K [b m: {~ {~ Ϛ J c r b  $> < Oj _ _ _ { V r ؞       f &B &B &B &B Z qJ : š 6 j j E WR WR n  j Һ Һ z1*1*1*1*1*_zrr* "1CCWw".jjjjԮ62nHHmV V4Hv]]]]mmVR  ,,A N[lwzNn!!<IWnf6! 7FbBbBbBsss#/=L_nm^zz6"2n& 3BnP^Rn|2NN2z.-n;zHvVdzs  vԞ b");NL]For}zB&mm66ff~~~~~~~~~~~~~~~  ͚)8^N[ j^r:2 j V !j!j!j!j!9!9!9!j !.!!z!!!!!!!!!!!!!!"9"9"9"9"""N"N"N"N"N"N"N"N"N"N"N"N"N"N"N"N"N"N"N#-#-#-#-#-#-#-#-#l#l#l#l#l#l#l#l#l#l#l#l#l###$J$J$J$J$96$96$96$96$96%"%"%"%"%"%"%"%"%"%?B%?B%Q%Q%{%{%{%{%%%%%%%%%%%%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ%Ũ&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@&!@'@'@'@'@'@'@'@'@'@'@'P'P'X'X'X'X(S|(S|(S|(S|)&@)&@)&@)&@)&@)_)_)_)_)_)_)_)_)_)_)_)_)_*5*Q*Q*Q++,8,8,8,8,N,N,y,(,(,(,(,(,(,(,(,(-&-&-&-&-&-[-~$-~$-~$-~$-P-P.RD.RD.h/x/͐202Ed2Ed2Z2e2r<2222X2202T2p2p2p2p3 3 3 3 3 3 3 3 3 3 3 3 3 3T3T3T3T3T3T33334p4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!5v5v5v5v5v5v5v5v5v5v5v5v5v5v5v5v5v5v7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ7ɠ88_exit_exit_thread__fork_waitpid__waitid__sys_cloneexecve__setuidgetuidgetgidgeteuidgetegidgetresuidgetresgidgettidgetgroupsgetpgidgetppidsetsidsetgid__setreuid__setresuidsetresgid__brkkilltkill__ptrace__set_thread_area__getprioritysetprioritysetrlimitgetrlimitgetrusagesetgroupssetpgidsetregidchrootprctlcapgetcapsetsigaltstackacctreadwritepread64pwrite64__open__openatcloselseek__llseekgetpid__mmap2munmapmremapmsyncmprotectmadvisemlockmunlockmincore__ioctlreadvwritev__fcntlflockfchmodduppipe2dup2selectftruncateftruncate64getdentsfsyncfdatasyncfchownsync__fcntl64__fstatfs64sendfilefstatatmkdiratfchownatfchmodatrenameatlinkunlinkunlinkatchdirmknodchmodchownlchownmountumount2fstatstatlstatmkdirreadlinkrmdirrename__getcwdaccesssymlinkfchdirtruncate__statfs64pausegettimeofdaysettimeofdaytimesnanosleepclock_gettimeclock_settimeclock_getresclock_nanosleepgetitimersetitimer__timer_create__timer_settime__timer_gettime__timer_getoverrun__timer_deleteutimesutimensatsigactionsigprocmask__sigsuspend__rt_sigaction__rt_sigprocmask__rt_sigtimedwaitsigpendingsocketsocketpairbindconnectlistenacceptgetsocknamegetpeernamesendtorecvfromshutdownsetsockoptgetsockoptsendmsgrecvmsgsched_setschedulersched_getschedulersched_yieldsched_setparamsched_getparamsched_get_priority_maxsched_get_priority_minsched_rr_get_intervalsched_setaffinity__sched_getaffinity__getcpuioprio_setioprio_getuname__wait4umask__reboot__sysloginit_moduledelete_moduleklogctlsysinfofutexepoll_createepoll_ctlepoll_waitinotify_initinotify_add_watchinotify_rm_watchpolleventfd_flush_cachesyscall__get_sp_exit_with_stack_teardown_setjmp_longjmp__atomic_dec__atomic_inc__atomic_cmpxchg__atomic_swap__futex_wait__futex_wake__futex_syscall3__futex_syscall4bzero__pthread_clone__bionic_cloneffs__memcmp16pipesetjmplongjmpsigsetjmpsiglongjmpvfork_memset16_memset32memsetmemcpyabortalarmbrk__bionic_brkcreatdaemoneventfdexecvexecvpexeclpexecleexeclfcntlfnmatchfstatfsftimeftokgetcwdgetdtablesizegethostnameoptindopterroptoptoptargoptresetgetopt_long_onlygetopt_longgetoptgetpgrpgetprioritygetptinitgroupsisattyissetugidkillpglseek64mmapniceopenopenatdirfdalphasortrewinddirclosedirreaddir_rfdopendiropendirreaddirscandirfpathconfpathconfperrorpclosepopenpreadpselectptsnameptsname_rpwriteraiserebootrecvsbrk__bionic_brksendsetegidsetuidseteuidsetreuidsetresuidsetpgrpsigblocksiginterruptsys_siglistsysv_signalbsd_signalsys_signamesigsetmasksigsuspendsigwaitsleepstatfsstrsignalsetlogmask_rsetlogmaskcloselog_rcloselogopenlog_ropenlogsyslogvsyslogvsyslog_rsyslog_rsystemtcgetpgrptcsetpgrpclocktimeumountunlockptusleepwaitidwaitpidwait3waitasprintfclearerrfclosefdopenfeofferror__sflush__sflush_lockedfflushfgetcfgetlnfgetposfgetsfileno__sinit__sdidinit_cleanup__sfp__sglue__sF__sflagsflockfilefunlockfile__fremovelockftrylockfilefopenfprintffpurgefputcfputsfreadfreopenfscanffseekofseekfsetposftelloftellfunopen__sfvwrite_fwalkfwritegetc_unlockedgetcgetchar_unlockedgetchargets__swhatbuf__smakebuf_mktempmktempmkdtempmkstempmkstempsprintfputc_unlockedputcputcharputchar_unlockedputsputw__srefillremoverewind__srgetscanfsetbufsetlinebufsetbuffersetvbufsnprintfsprintfsscanf__sclose__sseek__swrite__sreadtempnamtmpfiletmpnamungetcvasprintf__vfprintfvfprintfvfscanfvprintfvsnprintfvsprintfvscanfvsscanf__swbuf__swsetup__dorand48__rand48_mult__rand48_add__rand48_seed__assert2__assert__atexit_register_cleanup__atexit__atexit_invalid__cxa_finalize__cxa_atexitatoiatolatollbsearchisalnum_ctype_isalphaiscntrlisdigitisgraphislowerisprintispunctisspaceisupperisxdigitisblankisasciitoascii_C_ctype_divexit__isthreaded__findenvgetenvjrand48ldivlldivsetlocalelrand48mrand48nrand48putenvqsortseed48unsetenvsetenvlongjmperrorsrand48strntoimaxstrntoumaxfreedtoastrtod__dtoastrtoimaxstrtolstrtollstrtoulstrtoullstrtoumaxtolower_tolower_tab__C_tolower_toupper_toupper_tab__C_toupper_btowciswalnumiswalphaiswcntrliswdigitiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigitiswctypefwidembsinitmbrlenmbrtowctowlowertowupperwcrtombwctobwcwidthwctypewcswcswcstoulwcstolwcstodwcsrtombswcstombsmbsrtowcsmbstowcswcsftimeungetwcputwcharputwcfputwcgetwchargetwcfputwsfgetwsfgetwcswscanffwscanfvswprintfvfwprintfvwprintfwscanfswprintfwprintffwprintfindexmemccpymemchrmemmemmemrchrmemswapstrcasecmpstrncasecmpstrcasestrstrcatstrchrstrcollstrcspnstrdupstrerrorstrerror_rstrlcatstrlcpystrncatstrncpystrndupstrnlenstrpbrkstrrchrstrsepstrspnstrstrstrtok_rstrtokstrtotimevalstrxfrmwcpcpywcpncpywcscasecmpwcscatwcschrwcscmpwcscollwcscpywcscspnwcsdupwcslcatwcslcpywcslenwcsncasecmpwcsncatwcsncmpwcsncpywcsnlenwcspbrkwcsrchrwcsspnwcsstrwcstokwcswidthwcsxfrmwmemchrwmemcmpwmemcpywmemmovewmemsetbindresvportinet_addrinet_atoninet_ntoainet_ntopinet_ptonether_aton_rether_atonether_ntoa_rether_ntoaasctime_rasctimedifftimetznamedaylighttimezonemktimetimelocallocaltime_rlocaltimectimectime_rtzsetposix2timetime2posixgmtime_rgmtimetimegmstrftime_tzstrftimestrptime__set_errno__set_syscall_errnocpuacct_addarc4random_bufarc4randomarc4random_uniformarc4random_addrandomarc4random_stir__arc4_getbytebasenamebasename_rclearenvdirnamedirname_rdrand48erand48vwarnxvwarnwarnxwarnverrxerrxverrerrvfdprintffdprintfforkfts_setfts_closefts_childrenfts_readfts_openif_nametoindexif_indextonameioctlldexp__libc_fini__libc_init_common__prognameenviron__page_size__page_shift__libc_android_log_write__libc_android_log_assert__libc_android_log_print__libc_android_log_vprintMD5_InitMD5_UpdateMD5_Final_memmove_wordspututlinerealpathsched_getaffinitysched_getcpu__sched_cpufree__sched_cpualloc__sched_cpucountsem_getvaluesem_unlinksem_closesem_opensem_destroysem_initsem_trywaitsem_postsem_timedwaitsem_waitSHA1InitSHA1TransformSHA1UpdateSHA1Final__stack_chk_fail__stack_chk_guardgetgrouplistendpwentendusershellsetusershellgetusershellgetprotobynumbergetprotobynamegetnetbyaddrttyname_rttynamegetmntentgetnetbynamegetgrnamgetgrgidgetpwnamgetpwuidgetlogingetpwuid_rgetpwnam_r__system_property_find_nth__system_property_area____system_property_wait__system_property_set__system_property_read__system_property_find__system_property_get__system_properties_inittimegm64asctime64_rasctime64gmtime64_rgmtime64localtime64_rlocaltime64ctime64ctime64_rmktime64timelocal64fake_gmtime_rfake_localtime_r_thread_atexit_unlock_thread_atexit_lockutimeendutentutmpnamegetutentsetutentgethostentgethostbyaddrgethostbyname2gethostbynamegethostbyname_r__evConsTime__evAddTime__evSubTime__evCmpTime__evTimeSpec__evTimeVal__evUTCTime__evNowTime__evOptMonoTime__evConsIovec__evOptMonoTimeinet_nsap_addrinet_nsap_ntoahstrerrorh_errlistherrorh_nerr__res_hnok__res_ownok__res_mailok__res_dnok_getshort_getlong__putshort__putlong__dn_skipname__dn_compdn_expand__res_send_setqhook__res_send_setrhook__hostalias__res_opt__res_close__res_isourserverres_init__res_querydomainres_search__res_sendres_queryres_mkquery__fp_nquery__fp_query__p_query_res_opcodes__p_secstodate__p_option__sym_ntop__sym_ntos__p_rcode__p_rcode_syms__p_section__p_class__p_class_syms__p_type__p_type_syms__dn_count_labels__loc_aton__p_sockun__p_time__sym_ston__res_nametotype__res_nametoclass__p_fqnname__p_fqname__p_cdnname__p_cdname__res_pquery__loc_ntoa__p_key_syms__p_cert_syms__res_get_nibblesuffix__res_get_nibblesuffix2__res_getservers__res_nclose__res_setservers__res_ndestroy__res_randomid__res_vinit__res_ninitres_get_dns_changed__res_nopt__res_nmkquery__res_hostalias__res_nquery__res_nquerydomain__res_nsearch__res_ourserver_p__res_nameinquery__res_queriesmatch__res_nsend__res_put_state__res_get_static__res_get_state__get_h_errno_nres_resolv_set_default_iface_resolv_cache_lookup_resolv_cache_add_resolv_get_addr_of_iface_resolv_get_addr_of_default_iface_resolv_set_addr_of_iface_resolv_flush_cache_for_iface_cache_get_nameserver_addr_resolv_cache_get_nameserver__get_res_cache_resolv_set_nameservers_for_iface_resolv_cache_reset_resolv_flush_cache_for_default_ifacensdispatchgai_strerrorfreeaddrinfogetaddrinfogetnameinfogetservbynameendserventsetserventgetservent_rgetservent__b64_ntop__b64_ptongetservbyport__ns_name_rollback__ns_name_pton__ns_name_ntol__ns_name_skip__ns_name_unpack__ns_name_ntop__ns_name_uncompress__ns_name_pack__ns_name_compress__ns_msg_getflag_ns_flagdata__ns_skiprr__ns_parserr__ns_initparse__ns_format_ttl__ns_get16__ns_get32__ns_put16__ns_put32__ns_sprintrrf__ns_sprintrr__ns_makecanon__ns_samenameregcompregerrorregexecregfreeclone__bionic_clone_entry__get_tls__set_tlscacheflushstrlenbcopymemmovememcmpstrcmpstrcpystrncmp__bionic_atfork_run_preparepthread_atfork__bionic_atfork_run_parent__bionic_atfork_run_childpthread_rwlockattr_initpthread_rwlockattr_destroypthread_rwlockattr_setpsharedpthread_rwlockattr_getpsharedpthread_rwlock_unlockpthread_rwlock_trywrlockpthread_rwlock_tryrdlockpthread_rwlock_timedwrlockpthread_rwlock_wrlockpthread_rwlock_timedrdlockpthread_rwlock_rdlockpthread_rwlock_destroypthread_rwlock_inittimer_getoverruntimer_settime__timer_table_start_stoptimer_gettimetimer_deletetimer_create_thread_created_hookptracedl_iterate_phdrsysconf__errno__get_thread__get_stack_basepthread_attr_initpthread_attr_setdetachstatepthread_attr_getdetachstatepthread_attr_setschedpolicypthread_attr_getschedpolicypthread_attr_setschedparampthread_attr_getschedparampthread_attr_setstacksizepthread_attr_getstacksizepthread_attr_setstackaddrpthread_attr_getstackaddrpthread_attr_setstackpthread_attr_getstackpthread_attr_setguardsizepthread_attr_getguardsizepthread_getattr_nppthread_attr_setscopepthread_attr_getscope__pthread_cleanup_push__pthread_cleanup_poppthread_selfpthread_equalpthread_mutexattr_initpthread_mutexattr_destroypthread_mutexattr_gettypepthread_mutexattr_settypepthread_mutexattr_setpsharedpthread_mutexattr_getpsharedpthread_condattr_initpthread_condattr_getpsharedpthread_condattr_setpsharedpthread_condattr_destroypthread_cond_initpthread_cond_destroypthread_getspecificpthread_getcpuclockid__pthread_gettidpthread_setname_nppthread_sigmaskpthread_killpthread_mutex_initpthread_setschedparampthread_getschedparampthread_attr_destroy__init_tls__futex_wait_ex__futex_wake_expthread_cond_broadcastpthread_mutex_lock_timeout_nppthread_mutex_trylockpthread_mutex_destroypthread_mutex_unlockpthread_cond_signalpthread_mutex_lockpthread_once__pthread_cond_timedwait_relativepthread_cond_timeout_nppthread_cond_timedwait_relative_np__pthread_cond_timedwaitpthread_cond_timedwait_monotonic_nppthread_cond_timedwait_monotonicpthread_cond_timedwaitpthread_cond_waitpthread_detachpthread_join_init_threadpthread_createpthread_exit__thread_entrypthread_setspecificpthread_key_createpthread_key_deletedlmalloc_footprintdlmalloc_max_footprintdlmalloc_usable_sizedlmalloc_walk_heapdlmalloc_walk_free_pagesdlmalloptdlmallinfodlmalloc_statsdlfreedlmalloc_trimdlmallocdlmemaligndlpvallocdlvallocdlreallocdlcallocdlindependent_callocdlindependent_comallocmalloc__libc_malloc_dispatchfreecallocreallocmemalignvallocmalloc_debug_initfree_malloc_leak_infomallinfoget_malloc_leak_infogAllocationsMutexgHashTablegMallocLeakZygoteChild__libc_malloc_default_dispatch__libc_initwait4// 724 ` __set_thread_area.o/ clock_nanosleep.o/ __timer_create.o/ __timer_settime.o/ __timer_gettime.o/ __timer_getoverrun.o/ __timer_delete.o/ __rt_sigaction.o/ __rt_sigprocmask.o/ __rt_sigtimedwait.o/ sched_setscheduler.o/ sched_getscheduler.o/ sched_setparam.o/ sched_getparam.o/ sched_get_priority_max.o/ sched_get_priority_min.o/ sched_rr_get_interval.o/ sched_setaffinity.o/ __sched_getaffinity.o/ inotify_add_watch.o/ inotify_rm_watch.o/ _exit_with_stack_teardown.o/ if_nametoindex.o/ if_indextoname.o/ libc_init_common.o/ sched_getaffinity.o/ sched_cpualloc.o/ sched_cpucount.o/ system_properties.o/ pthread-atfork.o/ pthread-rwlocks.o/ pthread-timers.o/ dl_iterate_phdr_static.o/ malloc_debug_common.o/ libc_init_static.o/ _exit.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscalls_exit.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/_exit.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0_exit_gp_disp__set_errno  $  J _exit_thread.o/ 1331265327 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ bD bionic/libc/arch-mips/syscalls_exit_thread.S KKKKKLKKe0bionic/libc/arch-mips/syscalls/_exit_thread.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpfB VpiR   bpwtp p @   #   0_exit_thread_gp_disp__set_errno  $  Q __fork.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscalls__fork.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/__fork.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0__fork_gp_disp__set_errno  $  K _waitpid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscalls_waitpid.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/_waitpid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 _waitpid_gp_disp__set_errno  $  M __waitid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscalls__waitid.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__waitid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __waitid_gp_disp__set_errno  $  M __sys_clone.o/ 1331265327 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ aC bionic/libc/arch-mips/syscalls__sys_clone.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/__sys_clone.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 __sys_clone_gp_disp__set_errno  $  P execve.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsexecve.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/execve.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0execve_gp_disp__set_errno  $  K __setuid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscalls__setuid.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__setuid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __setuid_gp_disp__set_errno  $  M getuid.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsgetuid.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/getuid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0getuid_gp_disp__set_errno  $  K getgid.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsgetgid.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/getgid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0getgid_gp_disp__set_errno  $  K geteuid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallsgeteuid.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/geteuid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 geteuid_gp_disp__set_errno  $  L getegid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallsgetegid.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/getegid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 getegid_gp_disp__set_errno  $  L getresuid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!Z$ ! @ _A bionic/libc/arch-mips/syscallsgetresuid.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/getresuid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 getresuid_gp_disp__set_errno  $  N getresgid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!_$ ! @ _A bionic/libc/arch-mips/syscallsgetresgid.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/getresgid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 getresgid_gp_disp__set_errno  $  N gettid.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!~$ ! @ \> bionic/libc/arch-mips/syscallsgettid.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/gettid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0gettid_gp_disp__set_errno  $  K getgroups.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallsgetgroups.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/getgroups.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 getgroups_gp_disp__set_errno  $  N getpgid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$$ ! @ ]? bionic/libc/arch-mips/syscallsgetpgid.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/getpgid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 getpgid_gp_disp__set_errno  $  L getppid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallsgetppid.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/getppid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 getppid_gp_disp__set_errno  $  L setsid.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallssetsid.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/setsid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0setsid_gp_disp__set_errno  $  K setgid.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallssetgid.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/setgid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0setgid_gp_disp__set_errno  $  K __setreuid.o/ 1331265327 1002 1002 100644 1608 ` ELF,P4(<'!$ ! @ `B bionic/libc/arch-mips/syscalls__setreuid.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/__setreuid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 __setreuid_gp_disp__set_errno  $  O __setresuid.o/ 1331265327 1002 1002 100644 1616 ` ELF4P4(<'!Y$ ! @ aC bionic/libc/arch-mips/syscalls__setresuid.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/__setresuid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 __setresuid_gp_disp__set_errno  $  P setresgid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!^$ ! @ _A bionic/libc/arch-mips/syscallssetresgid.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/setresgid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 setresgid_gp_disp__set_errno  $  N __brk.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscalls__brk.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/__brk.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0__brk_gp_disp__set_errno  $  J kill.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ Z< bionic/libc/arch-mips/syscallskill.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/kill.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0kill_gp_disp__set_errno  $  I tkill.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallstkill.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/tkill.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0tkill_gp_disp__set_errno  $  J __ptrace.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscalls__ptrace.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__ptrace.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __ptrace_gp_disp__set_errno  $  M /0 1331265327 1002 1002 100644 1628 ` ELF<P4(<'!$ ! @ gI bionic/libc/arch-mips/syscalls__set_thread_area.S KKKKKLKKj0bionic/libc/arch-mips/syscalls/__set_thread_area.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpkB $VpnR ,  bptp p L    (   0__set_thread_area_gp_disp__set_errno  $  V __getpriority.o/1331265327 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ cE bionic/libc/arch-mips/syscalls__getpriority.S KKKKKLKKf0bionic/libc/arch-mips/syscalls/__getpriority.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpgB VpjR   bpytp p @   $   0__getpriority_gp_disp__set_errno  $  R setpriority.o/ 1331265327 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ aC bionic/libc/arch-mips/syscallssetpriority.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/setpriority.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 setpriority_gp_disp__set_errno  $  P setrlimit.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallssetrlimit.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/setrlimit.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 setrlimit_gp_disp__set_errno  $  N getrlimit.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallsgetrlimit.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/getrlimit.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 getrlimit_gp_disp__set_errno  $  N getrusage.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallsgetrusage.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/getrusage.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 getrusage_gp_disp__set_errno  $  N setgroups.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallssetgroups.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/setgroups.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 setgroups_gp_disp__set_errno  $  N setpgid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallssetpgid.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/setpgid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 setpgid_gp_disp__set_errno  $  L setregid.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscallssetregid.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/setregid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 setregid_gp_disp__set_errno  $  M chroot.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallschroot.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/chroot.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0chroot_gp_disp__set_errno  $  K prctl.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!`$ ! @ [= bionic/libc/arch-mips/syscallsprctl.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/prctl.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0prctl_gp_disp__set_errno  $  J capget.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!l$ ! @ \> bionic/libc/arch-mips/syscallscapget.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/capget.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0capget_gp_disp__set_errno  $  K capset.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!m$ ! @ \> bionic/libc/arch-mips/syscallscapset.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/capset.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0capset_gp_disp__set_errno  $  K sigaltstack.o/ 1331265327 1002 1002 100644 1616 ` ELF4P4(<'!n$ ! @ aC bionic/libc/arch-mips/syscallssigaltstack.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/sigaltstack.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 sigaltstack_gp_disp__set_errno  $  P acct.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ Z< bionic/libc/arch-mips/syscallsacct.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/acct.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0acct_gp_disp__set_errno  $  I read.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ Z< bionic/libc/arch-mips/syscallsread.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/read.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0read_gp_disp__set_errno  $  I write.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallswrite.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/write.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0write_gp_disp__set_errno  $  J pread64.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!h$ ! @ ]? bionic/libc/arch-mips/syscallspread64.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/pread64.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 pread64_gp_disp__set_errno  $  L pwrite64.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!i$ ! @ ^@ bionic/libc/arch-mips/syscallspwrite64.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/pwrite64.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 pwrite64_gp_disp__set_errno  $  M __open.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscalls__open.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/__open.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0__open_gp_disp__set_errno  $  K __openat.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscalls__openat.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__openat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __openat_gp_disp__set_errno  $  M close.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsclose.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/close.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0close_gp_disp__set_errno  $  J lseek.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallslseek.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/lseek.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0lseek_gp_disp__set_errno  $  J __llseek.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!,$ ! @ ^@ bionic/libc/arch-mips/syscalls__llseek.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__llseek.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __llseek_gp_disp__set_errno  $  M getpid.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsgetpid.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/getpid.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0getpid_gp_disp__set_errno  $  K __mmap2.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!r$ ! @ ]? bionic/libc/arch-mips/syscalls__mmap2.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/__mmap2.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 __mmap2_gp_disp__set_errno  $  L munmap.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsmunmap.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/munmap.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0munmap_gp_disp__set_errno  $  K mremap.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!G$ ! @ \> bionic/libc/arch-mips/syscallsmremap.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/mremap.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0mremap_gp_disp__set_errno  $  K msync.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!0$ ! @ [= bionic/libc/arch-mips/syscallsmsync.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/msync.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0msync_gp_disp__set_errno  $  J mprotect.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscallsmprotect.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/mprotect.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 mprotect_gp_disp__set_errno  $  M madvise.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!z$ ! @ ]? bionic/libc/arch-mips/syscallsmadvise.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/madvise.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 madvise_gp_disp__set_errno  $  L mlock.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!:$ ! @ [= bionic/libc/arch-mips/syscallsmlock.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/mlock.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0mlock_gp_disp__set_errno  $  J munlock.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!;$ ! @ ]? bionic/libc/arch-mips/syscallsmunlock.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/munlock.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 munlock_gp_disp__set_errno  $  L mincore.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!y$ ! @ ]? bionic/libc/arch-mips/syscallsmincore.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/mincore.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 mincore_gp_disp__set_errno  $  L __ioctl.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscalls__ioctl.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/__ioctl.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 __ioctl_gp_disp__set_errno  $  L readv.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!1$ ! @ [= bionic/libc/arch-mips/syscallsreadv.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/readv.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0readv_gp_disp__set_errno  $  J writev.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!2$ ! @ \> bionic/libc/arch-mips/syscallswritev.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/writev.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0writev_gp_disp__set_errno  $  K __fcntl.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscalls__fcntl.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/__fcntl.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 __fcntl_gp_disp__set_errno  $  L flock.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!/$ ! @ [= bionic/libc/arch-mips/syscallsflock.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/flock.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0flock_gp_disp__set_errno  $  J fchmod.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsfchmod.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/fchmod.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0fchmod_gp_disp__set_errno  $  K dup.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ Y; bionic/libc/arch-mips/syscallsdup.S KKKKKLKK\0bionic/libc/arch-mips/syscalls/dup.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp]B Vp`R   bpetp p (      0dup_gp_disp__set_errno  $  H pipe2.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallspipe2.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/pipe2.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0pipe2_gp_disp__set_errno  $  J dup2.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ Z< bionic/libc/arch-mips/syscallsdup2.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/dup2.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0dup2_gp_disp__set_errno  $  I select.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!.$ ! @ \> bionic/libc/arch-mips/syscallsselect.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/select.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0select_gp_disp__set_errno  $  K ftruncate.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallsftruncate.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/ftruncate.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 ftruncate_gp_disp__set_errno  $  N ftruncate64.o/ 1331265327 1002 1002 100644 1616 ` ELF4P4(<'!t$ ! @ aC bionic/libc/arch-mips/syscallsftruncate64.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/ftruncate64.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 ftruncate64_gp_disp__set_errno  $  P getdents.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!{$ ! @ ^@ bionic/libc/arch-mips/syscallsgetdents.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/getdents.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 getdents_gp_disp__set_errno  $  M fsync.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsfsync.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/fsync.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0fsync_gp_disp__set_errno  $  J fdatasync.o/ 1331265327 1002 1002 100644 1604 ` ELF,P4(<'!8$ ! @ _A bionic/libc/arch-mips/syscallsfdatasync.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/fdatasync.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 fdatasync_gp_disp__set_errno  $  N fchown.o/ 1331265327 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsfchown.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/fchown.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0fchown_gp_disp__set_errno  $  K sync.o/ 1331265327 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ Z< bionic/libc/arch-mips/syscallssync.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/sync.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0sync_gp_disp__set_errno  $  I __fcntl64.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!|$ ! @ _A bionic/libc/arch-mips/syscalls__fcntl64.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/__fcntl64.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 __fcntl64_gp_disp__set_errno  $  N __fstatfs64.o/ 1331265328 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ aC bionic/libc/arch-mips/syscalls__fstatfs64.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/__fstatfs64.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 __fstatfs64_gp_disp__set_errno  $  P sendfile.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!o$ ! @ ^@ bionic/libc/arch-mips/syscallssendfile.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/sendfile.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 sendfile_gp_disp__set_errno  $  M fstatat.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallsfstatat.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/fstatat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 fstatat_gp_disp__set_errno  $  L mkdirat.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallsmkdirat.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/mkdirat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 mkdirat_gp_disp__set_errno  $  L fchownat.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscallsfchownat.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/fchownat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 fchownat_gp_disp__set_errno  $  M fchmodat.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscallsfchmodat.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/fchmodat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 fchmodat_gp_disp__set_errno  $  M renameat.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscallsrenameat.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/renameat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 renameat_gp_disp__set_errno  $  M link.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ Z< bionic/libc/arch-mips/syscallslink.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/link.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0link_gp_disp__set_errno  $  I unlink.o/ 1331265328 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsunlink.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/unlink.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0unlink_gp_disp__set_errno  $  K unlinkat.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscallsunlinkat.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/unlinkat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 unlinkat_gp_disp__set_errno  $  M chdir.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallschdir.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/chdir.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0chdir_gp_disp__set_errno  $  J mknod.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsmknod.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/mknod.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0mknod_gp_disp__set_errno  $  J chmod.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallschmod.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/chmod.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0chmod_gp_disp__set_errno  $  J chown.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!j$ ! @ [= bionic/libc/arch-mips/syscallschown.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/chown.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0chown_gp_disp__set_errno  $  J lchown.o/ 1331265328 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallslchown.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/lchown.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0lchown_gp_disp__set_errno  $  K mount.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsmount.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/mount.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0mount_gp_disp__set_errno  $  J umount2.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallsumount2.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/umount2.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 umount2_gp_disp__set_errno  $  L fstat.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!w$ ! @ [= bionic/libc/arch-mips/syscallsfstat.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/fstat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0fstat_gp_disp__set_errno  $  J stat.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!u$ ! @ Z< bionic/libc/arch-mips/syscallsstat.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/stat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0stat_gp_disp__set_errno  $  I lstat.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!v$ ! @ [= bionic/libc/arch-mips/syscallslstat.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/lstat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0lstat_gp_disp__set_errno  $  J mkdir.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsmkdir.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/mkdir.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0mkdir_gp_disp__set_errno  $  J readlink.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscallsreadlink.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/readlink.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 readlink_gp_disp__set_errno  $  M rmdir.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsrmdir.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/rmdir.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0rmdir_gp_disp__set_errno  $  J rename.o/ 1331265328 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsrename.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/rename.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0rename_gp_disp__set_errno  $  K __getcwd.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!k$ ! @ ^@ bionic/libc/arch-mips/syscalls__getcwd.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__getcwd.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __getcwd_gp_disp__set_errno  $  M access.o/ 1331265328 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsaccess.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/access.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0access_gp_disp__set_errno  $  K symlink.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallssymlink.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/symlink.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 symlink_gp_disp__set_errno  $  L fchdir.o/ 1331265328 1002 1002 100644 1596 ` ELF$P4(<'!%$ ! @ \> bionic/libc/arch-mips/syscallsfchdir.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/fchdir.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0fchdir_gp_disp__set_errno  $  K truncate.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscallstruncate.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/truncate.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 truncate_gp_disp__set_errno  $  M __statfs64.o/ 1331265328 1002 1002 100644 1608 ` ELF,P4(<'!$ ! @ `B bionic/libc/arch-mips/syscalls__statfs64.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/__statfs64.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 __statfs64_gp_disp__set_errno  $  O pause.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallspause.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/pause.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0pause_gp_disp__set_errno  $  J gettimeofday.o/ 1331265328 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ bD bionic/libc/arch-mips/syscallsgettimeofday.S KKKKKLKKe0bionic/libc/arch-mips/syscalls/gettimeofday.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpfB VpiR   bpwtp p @   #   0gettimeofday_gp_disp__set_errno  $  Q settimeofday.o/ 1331265328 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ bD bionic/libc/arch-mips/syscallssettimeofday.S KKKKKLKKe0bionic/libc/arch-mips/syscalls/settimeofday.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpfB VpiR   bpwtp p @   #   0settimeofday_gp_disp__set_errno  $  Q times.o/ 1331265328 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallstimes.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/times.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0times_gp_disp__set_errno  $  J nanosleep.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!F$ ! @ _A bionic/libc/arch-mips/syscallsnanosleep.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/nanosleep.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 nanosleep_gp_disp__set_errno  $  N clock_gettime.o/1331265328 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ cE bionic/libc/arch-mips/syscallsclock_gettime.S KKKKKLKKf0bionic/libc/arch-mips/syscalls/clock_gettime.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpgB VpjR   bpytp p @   $   0clock_gettime_gp_disp__set_errno  $  R clock_settime.o/1331265328 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ cE bionic/libc/arch-mips/syscallsclock_settime.S KKKKKLKKf0bionic/libc/arch-mips/syscalls/clock_settime.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpgB VpjR   bpytp p @   $   0clock_settime_gp_disp__set_errno  $  R clock_getres.o/ 1331265328 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ bD bionic/libc/arch-mips/syscallsclock_getres.S KKKKKLKKe0bionic/libc/arch-mips/syscalls/clock_getres.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpfB VpiR   bpwtp p @   #   0clock_getres_gp_disp__set_errno  $  Q /21 1331265328 1002 1002 100644 1628 ` ELF<P4(<'!$ ! @ eG bionic/libc/arch-mips/syscallsclock_nanosleep.S KKKKKLKKh0bionic/libc/arch-mips/syscalls/clock_nanosleep.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpiB $VplR ,  bp}tp p L    &   0clock_nanosleep_gp_disp__set_errno  $  T getitimer.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'! $ ! @ _A bionic/libc/arch-mips/syscallsgetitimer.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/getitimer.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 getitimer_gp_disp__set_errno  $  N setitimer.o/ 1331265328 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallssetitimer.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/setitimer.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 setitimer_gp_disp__set_errno  $  N /40 1331265328 1002 1002 100644 1620 ` ELF4P4(<'!$ ! @ dF bionic/libc/arch-mips/syscalls__timer_create.S KKKKKLKKg0bionic/libc/arch-mips/syscalls/__timer_create.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FphB VpkR $  bp{tp p D   %   0__timer_create_gp_disp__set_errno  $  S /58 1331265328 1002 1002 100644 1628 ` ELF<P4(<'!$ ! @ eG bionic/libc/arch-mips/syscalls__timer_settime.S KKKKKLKKh0bionic/libc/arch-mips/syscalls/__timer_settime.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpiB $VplR ,  bp}tp p L    &   0__timer_settime_gp_disp__set_errno  $  T /77 1331265328 1002 1002 100644 1628 ` ELF<P4(<'!$ ! @ eG bionic/libc/arch-mips/syscalls__timer_gettime.S KKKKKLKKh0bionic/libc/arch-mips/syscalls/__timer_gettime.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpiB $VplR ,  bp}tp p L    &   0__timer_gettime_gp_disp__set_errno  $  T /96 1331265328 1002 1002 100644 1632 ` ELF<P4(<'!$ ! @ hJ bionic/libc/arch-mips/syscalls__timer_getoverrun.S KKKKKLKKk0bionic/libc/arch-mips/syscalls/__timer_getoverrun.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FplB (VpoR 0  bptp p P    )   0__timer_getoverrun_gp_disp__set_errno  $  W /118 1331265328 1002 1002 100644 1620 ` ELF4P4(<'!$ ! @ dF bionic/libc/arch-mips/syscalls__timer_delete.S KKKKKLKKg0bionic/libc/arch-mips/syscalls/__timer_delete.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FphB VpkR $  bp{tp p D   %   0__timer_delete_gp_disp__set_errno  $  S utimes.o/ 1331265328 1002 1002 100644 1596 ` ELF$P4(<'!$ ! @ \> bionic/libc/arch-mips/syscallsutimes.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/utimes.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0utimes_gp_disp__set_errno  $  K utimensat.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallsutimensat.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/utimensat.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 utimensat_gp_disp__set_errno  $  N sigaction.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallssigaction.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/sigaction.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 sigaction_gp_disp__set_errno  $  N sigprocmask.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ aC bionic/libc/arch-mips/syscallssigprocmask.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/sigprocmask.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 sigprocmask_gp_disp__set_errno  $  P __sigsuspend.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ bD bionic/libc/arch-mips/syscalls__sigsuspend.S KKKKKLKKe0bionic/libc/arch-mips/syscalls/__sigsuspend.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpfB VpiR   bpwtp p @   #   0__sigsuspend_gp_disp__set_errno  $  Q /136 1331265329 1002 1002 100644 1620 ` ELF4P4(<'!b$ ! @ dF bionic/libc/arch-mips/syscalls__rt_sigaction.S KKKKKLKKg0bionic/libc/arch-mips/syscalls/__rt_sigaction.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FphB VpkR $  bp{tp p D   %   0__rt_sigaction_gp_disp__set_errno  $  S /154 1331265329 1002 1002 100644 1628 ` ELF<P4(<'!c$ ! @ fH bionic/libc/arch-mips/syscalls__rt_sigprocmask.S KKKKKLKKi0bionic/libc/arch-mips/syscalls/__rt_sigprocmask.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpjB $VpmR ,  bptp p L    '   0__rt_sigprocmask_gp_disp__set_errno  $  U /174 1331265329 1002 1002 100644 1628 ` ELF<P4(<'!e$ ! @ gI bionic/libc/arch-mips/syscalls__rt_sigtimedwait.S KKKKKLKKj0bionic/libc/arch-mips/syscalls/__rt_sigtimedwait.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpkB $VpnR ,  bptp p L    (   0__rt_sigtimedwait_gp_disp__set_errno  $  V sigpending.o/ 1331265329 1002 1002 100644 1608 ` ELF,P4(<'!$ ! @ `B bionic/libc/arch-mips/syscallssigpending.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/sigpending.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 sigpending_gp_disp__set_errno  $  O socket.o/ 1331265329 1002 1002 100644 1596 ` ELF$P4(<'!W$ ! @ \> bionic/libc/arch-mips/syscallssocket.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/socket.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0socket_gp_disp__set_errno  $  K socketpair.o/ 1331265329 1002 1002 100644 1608 ` ELF,P4(<'!X$ ! @ `B bionic/libc/arch-mips/syscallssocketpair.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/socketpair.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 socketpair_gp_disp__set_errno  $  O bind.o/ 1331265329 1002 1002 100644 1592 ` ELF$P4(<'!I$ ! @ Z< bionic/libc/arch-mips/syscallsbind.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/bind.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0bind_gp_disp__set_errno  $  I connect.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!J$ ! @ ]? bionic/libc/arch-mips/syscallsconnect.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/connect.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 connect_gp_disp__set_errno  $  L listen.o/ 1331265329 1002 1002 100644 1596 ` ELF$P4(<'!N$ ! @ \> bionic/libc/arch-mips/syscallslisten.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/listen.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0listen_gp_disp__set_errno  $  K accept.o/ 1331265329 1002 1002 100644 1596 ` ELF$P4(<'!H$ ! @ \> bionic/libc/arch-mips/syscallsaccept.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/accept.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0accept_gp_disp__set_errno  $  K getsockname.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'!L$ ! @ aC bionic/libc/arch-mips/syscallsgetsockname.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/getsockname.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 getsockname_gp_disp__set_errno  $  P getpeername.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'!K$ ! @ aC bionic/libc/arch-mips/syscallsgetpeername.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/getpeername.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 getpeername_gp_disp__set_errno  $  P sendto.o/ 1331265329 1002 1002 100644 1596 ` ELF$P4(<'!T$ ! @ \> bionic/libc/arch-mips/syscallssendto.S KKKKKLKK_0bionic/libc/arch-mips/syscalls/sendto.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp`B VpcR   bpktp p ,      0sendto_gp_disp__set_errno  $  K recvfrom.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!P$ ! @ ^@ bionic/libc/arch-mips/syscallsrecvfrom.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/recvfrom.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 recvfrom_gp_disp__set_errno  $  M shutdown.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!V$ ! @ ^@ bionic/libc/arch-mips/syscallsshutdown.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/shutdown.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 shutdown_gp_disp__set_errno  $  M setsockopt.o/ 1331265329 1002 1002 100644 1608 ` ELF,P4(<'!U$ ! @ `B bionic/libc/arch-mips/syscallssetsockopt.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/setsockopt.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 setsockopt_gp_disp__set_errno  $  O getsockopt.o/ 1331265329 1002 1002 100644 1608 ` ELF,P4(<'!M$ ! @ `B bionic/libc/arch-mips/syscallsgetsockopt.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/getsockopt.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 getsockopt_gp_disp__set_errno  $  O sendmsg.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!S$ ! @ ]? bionic/libc/arch-mips/syscallssendmsg.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/sendmsg.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 sendmsg_gp_disp__set_errno  $  L recvmsg.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!Q$ ! @ ]? bionic/libc/arch-mips/syscallsrecvmsg.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/recvmsg.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 recvmsg_gp_disp__set_errno  $  L /195 1331265329 1002 1002 100644 1632 ` ELF<P4(<'!@$ ! @ hJ bionic/libc/arch-mips/syscallssched_setscheduler.S KKKKKLKKk0bionic/libc/arch-mips/syscalls/sched_setscheduler.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FplB (VpoR 0  bptp p P    )   0sched_setscheduler_gp_disp__set_errno  $  W /217 1331265329 1002 1002 100644 1632 ` ELF<P4(<'!A$ ! @ hJ bionic/libc/arch-mips/syscallssched_getscheduler.S KKKKKLKKk0bionic/libc/arch-mips/syscalls/sched_getscheduler.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FplB (VpoR 0  bptp p P    )   0sched_getscheduler_gp_disp__set_errno  $  W sched_yield.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'!B$ ! @ aC bionic/libc/arch-mips/syscallssched_yield.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/sched_yield.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 sched_yield_gp_disp__set_errno  $  P /239 1331265329 1002 1002 100644 1620 ` ELF4P4(<'!>$ ! @ dF bionic/libc/arch-mips/syscallssched_setparam.S KKKKKLKKg0bionic/libc/arch-mips/syscalls/sched_setparam.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FphB VpkR $  bp{tp p D   %   0sched_setparam_gp_disp__set_errno  $  S /257 1331265329 1002 1002 100644 1620 ` ELF4P4(<'!?$ ! @ dF bionic/libc/arch-mips/syscallssched_getparam.S KKKKKLKKg0bionic/libc/arch-mips/syscalls/sched_getparam.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FphB VpkR $  bp{tp p D   %   0sched_getparam_gp_disp__set_errno  $  S /275 1331265329 1002 1002 100644 1644 ` ELFDP4(<'!C$ ! @ lN bionic/libc/arch-mips/syscallssched_get_priority_max.S KKKKKLKKo0bionic/libc/arch-mips/syscalls/sched_get_priority_max.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 ,FppB 4VpsR <  bptp p \   -   0!sched_get_priority_max_gp_disp__set_errno  $  [ /301 1331265329 1002 1002 100644 1644 ` ELFDP4(<'!D$ ! @ lN bionic/libc/arch-mips/syscallssched_get_priority_min.S KKKKKLKKo0bionic/libc/arch-mips/syscalls/sched_get_priority_min.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 ,FppB 4VpsR <  bptp p \   -   0!sched_get_priority_min_gp_disp__set_errno  $  [ /327 1331265329 1002 1002 100644 1640 ` ELFDP4(<'!E$ ! @ kM bionic/libc/arch-mips/syscallssched_rr_get_interval.S KKKKKLKKn0bionic/libc/arch-mips/syscalls/sched_rr_get_interval.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 (FpoB 0VprR 8  bptp p X   ,   0 sched_rr_get_interval_gp_disp__set_errno  $  Z /352 1331265329 1002 1002 100644 1628 ` ELF<P4(<'!$ ! @ gI bionic/libc/arch-mips/syscallssched_setaffinity.S KKKKKLKKj0bionic/libc/arch-mips/syscalls/sched_setaffinity.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpkB $VpnR ,  bptp p L    (   0sched_setaffinity_gp_disp__set_errno  $  V /373 1331265329 1002 1002 100644 1640 ` ELFDP4(<'!$ ! @ iK bionic/libc/arch-mips/syscalls__sched_getaffinity.S KKKKKLKKl0bionic/libc/arch-mips/syscalls/__sched_getaffinity.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 (FpmB 0VppR 8  bptp p X   *   0__sched_getaffinity_gp_disp__set_errno  $  X __getcpu.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscalls__getcpu.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__getcpu.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __getcpu_gp_disp__set_errno  $  M ioprio_set.o/ 1331265329 1002 1002 100644 1608 ` ELF,P4(<'!$ ! @ `B bionic/libc/arch-mips/syscallsioprio_set.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/ioprio_set.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 ioprio_set_gp_disp__set_errno  $  O ioprio_get.o/ 1331265329 1002 1002 100644 1608 ` ELF,P4(<'!$ ! @ `B bionic/libc/arch-mips/syscallsioprio_get.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/ioprio_get.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 ioprio_get_gp_disp__set_errno  $  O uname.o/ 1331265329 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsuname.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/uname.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0uname_gp_disp__set_errno  $  J __wait4.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscalls__wait4.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/__wait4.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 __wait4_gp_disp__set_errno  $  L umask.o/ 1331265329 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsumask.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/umask.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0umask_gp_disp__set_errno  $  J __reboot.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscalls__reboot.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__reboot.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __reboot_gp_disp__set_errno  $  M __syslog.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ^@ bionic/libc/arch-mips/syscalls__syslog.S KKKKKLKKa0bionic/libc/arch-mips/syscalls/__syslog.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpbB Vp eR   bpotp p 4      0 __syslog_gp_disp__set_errno  $  M init_module.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'! $ ! @ aC bionic/libc/arch-mips/syscallsinit_module.S KKKKKLKKd0bionic/libc/arch-mips/syscalls/init_module.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpeB Vp hR   bputp p @   "   0 init_module_gp_disp__set_errno  $  P delete_module.o/1331265329 1002 1002 100644 1616 ` ELF4P4(<'!!$ ! @ cE bionic/libc/arch-mips/syscallsdelete_module.S KKKKKLKKf0bionic/libc/arch-mips/syscalls/delete_module.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpgB VpjR   bpytp p @   $   0delete_module_gp_disp__set_errno  $  R klogctl.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallsklogctl.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/klogctl.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 klogctl_gp_disp__set_errno  $  L sysinfo.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallssysinfo.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/sysinfo.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 sysinfo_gp_disp__set_errno  $  L futex.o/ 1331265329 1002 1002 100644 1592 ` ELF$P4(<'!$ ! @ [= bionic/libc/arch-mips/syscallsfutex.S KKKKKLKK^0bionic/libc/arch-mips/syscalls/futex.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp_B VpbR   bpitp p (      0futex_gp_disp__set_errno  $  J epoll_create.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ bD bionic/libc/arch-mips/syscallsepoll_create.S KKKKKLKKe0bionic/libc/arch-mips/syscalls/epoll_create.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpfB VpiR   bpwtp p @   #   0epoll_create_gp_disp__set_errno  $  Q epoll_ctl.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ _A bionic/libc/arch-mips/syscallsepoll_ctl.S KKKKKLKKb0bionic/libc/arch-mips/syscalls/epoll_ctl.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpcB Vp fR   bpqtp p 4       0 epoll_ctl_gp_disp__set_errno  $  N epoll_wait.o/ 1331265329 1002 1002 100644 1608 ` ELF,P4(<'!$ ! @ `B bionic/libc/arch-mips/syscallsepoll_wait.S KKKKKLKKc0bionic/libc/arch-mips/syscalls/epoll_wait.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpdB Vp gR   bpstp p 8   !   0 epoll_wait_gp_disp__set_errno  $  O inotify_init.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'!$ ! @ bD bionic/libc/arch-mips/syscallsinotify_init.S KKKKKLKKe0bionic/libc/arch-mips/syscalls/inotify_init.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpfB VpiR   bpwtp p @   #   0inotify_init_gp_disp__set_errno  $  Q /396 1331265329 1002 1002 100644 1628 ` ELF<P4(<'!$ ! @ gI bionic/libc/arch-mips/syscallsinotify_add_watch.S KKKKKLKKj0bionic/libc/arch-mips/syscalls/inotify_add_watch.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpkB $VpnR ,  bptp p L    (   0inotify_add_watch_gp_disp__set_errno  $  V /417 1331265329 1002 1002 100644 1628 ` ELF<P4(<'!$ ! @ fH bionic/libc/arch-mips/syscallsinotify_rm_watch.S KKKKKLKKi0bionic/libc/arch-mips/syscalls/inotify_rm_watch.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpjB $VpmR ,  bptp p L    '   0inotify_rm_watch_gp_disp__set_errno  $  U poll.o/ 1331265329 1002 1002 100644 1592 ` ELF$P4(<'!\$ ! @ Z< bionic/libc/arch-mips/syscallspoll.S KKKKKLKK]0bionic/libc/arch-mips/syscalls/poll.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 Fp^B VpaR   bpgtp p (      0poll_gp_disp__set_errno  $  I eventfd.o/ 1331265330 1002 1002 100644 6256 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallseventfd.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/eventfd.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 eventfd_gp_disp__set_errno  $  L ELF,P4(#  % RU$ > $ > : ; I$ > .? : ; ' I@: ; I: ; I 4: ; I  I 4: ; I? < Qint!8eS3j8Z)(E.)Lfd) 3 ret)s-)@h4fd)4 ret )  0 0 bionic/libc/unistdbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/include/syseventfd.c_types.hstdint.heventfd.hunistd.huIKIKuKIK<'!'(,(' $B8$ !` '<'!' $B8$ !` ' | LP D@P D | LP D,@P DL 0T $VW$((W(L(@ $T $U1Ueventfd_writeeventfd_read$L@L@long long intunsigned intunsigned chareventfd_tlong unsigned inteventfd_writelong long unsigned intuint64_teventfd_read/u/raghu/ics_feb29__page_shiftGNU C 4.4.3charlong intdoublebionic/libc/unistd/eventfd.ccountershort unsigned intsigned char__page_sizefloatshort int__uint64_tGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.eventfd_write.rel.text.eventfd_read.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp^p8UZ (! npj ! ~xLz ! @ !p@  !D@ <!p L!p25 !pg( !p  !p0,0$o4 " TM   L ,5;@Hbionic/libc/unistd/eventfd.ceventfd_write_gp_dispwriteeventfd_readread  !%3:AHOV[hov}         $ ;H      , 0  0      $ 3 7 C G T X h l t x           _flush_cache.o/ 1331265329 1002 1002 100644 1616 ` ELF4P4(<'!3$ ! @ bD bionic/libc/arch-mips/syscalls_flush_cache.S KKKKKLKKe0bionic/libc/arch-mips/syscalls/_flush_cache.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpfB VpiR   bpwtp p @   #   0_flush_cache_gp_disp__set_errno  $  Q syscall.o/ 1331265329 1002 1002 100644 1604 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallssyscall.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/syscall.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 syscall_gp_disp__set_errno  $  L __get_sp.o/ 1331265329 1002 1002 100644 1436 ` ELFP4(!T> bionic/libc/arch-mips/bionic__get_sp.S$K_bionic/libc/arch-mips/bionic/__get_sp.S/u/raghu/ics_feb29GNU AS 2.21.1%.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@!P'P,pP9h 5 \BpX> dRpcN l  ^pCppX l  x  P    __get_sp K /437 1331265329 1002 1002 100644 1508 ` ELF0P4(!$ ! $ ! TkO bionic/libc/arch-mips/bionic_exit_with_stack_teardown.S'LKKKKMKp bionic/libc/arch-mips/bionic/_exit_with_stack_teardown.S/u/raghu/ics_feb29GNU AS 2.21.1% .symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@ !`'`,p`9x 5 Bpo> RptN   ^p{pp l        _exit_with_stack_teardown \ _setjmp.o/ 1331265329 1002 1002 100644 2200 ` ELFP4(<'!'<޺B4PTX\`dhl '$BD '!<'!'<޺!4APTX\`dhlDĸ$!   '6  = bionic/libc/arch-mips/bionic_setjmp.S9LOKKKKKKKKKKKKKKMKKJKKKKKKKKKKKLMKKLLKKKKKKKKKKKKKLJKKKKKKKKKKKMKKLKMKL^tbionic/libc/arch-mips/bionic/_setjmp.S/u/raghu/ics_feb29GNU AS 2.21.1%t.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@ @%+0p=@9 PFpB `VpbR h  bp"tp8 p  X   B H   &/<FRAMESZGPOFFbotch_setjmp_gp_disp_longjmplongjmperrorabortH L%\ `% J  atomics_mips.o/ 1331265329 1002 1002 100644 2440 ` ELFP4(H$H$!H $$!@'!8!0$$ "!''!8!0$$ "!''!8$ "!''$ "!'B bionic/libc/arch-mips/bionicatomics_mips.S0KKK  P RpgN X  ^ppp0 l x  Px   v   $0$`0,$:8G8T@0ep,__atomic_dec__atomic_inc__atomic_cmpxchg__atomic_swap__futex_wait__futex_wake__futex_syscall3__futex_syscall4  @ ` O bzero.o/ 1331265329 1002 1002 100644 1564 ` ELF P4(<'!!0 !(`T; bionic/libc/arch-mips/bionicbzero.S&KKK\bionic/libc/arch-mips/bionic/bzero.S/u/raghu/ics_feb29GNU AS 2.21.1%.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@  %`+`0p`=x 9 FpXB Vp`R   bpPtph p       bzero_gp_dispmemset    H clone.o/ 1331265329 1002 1002 100644 2000 ` ELFP4(<'!$! !0!8 pRp^N x  ^pMpph l    `   ffs F memcmp16.o/ 1331265329 1002 1002 100644 1524 ` ELF8P4($  $  $$$# t_> bionic/libc/arch-mips/bionicmemcmp16.S%KKKKKKKKKK_<bionic/libc/arch-mips/bionic/memcmp16.S/u/raghu/ics_feb29GNU AS 2.21.1%<.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@@!',p9 5 Bpc> RpcN   ^p~pp l    4   <done__memcmp16 K pipe.o/ 1331265329 1002 1002 100644 1448 ` ELFP4($ !T: bionic/libc/arch-mips/bionicpipe.S)KLKKK[bionic/libc/arch-mips/bionic/pipe.S/u/raghu/ics_feb29GNU AS 2.21.1%.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@ !`'`,p`9x 5 hBpX> pRp_N x  ^pOpph l    `   pipe G setjmp.o/ 1331265329 1002 1002 100644 2420 ` ELF$P4(<'!'! b<޺B4PTX\`dhl '$BD! '   '<'!' <޺!4APTX\`dhlDĸ$!>  < bionic/libc/arch-mips/bionicsetjmp.S:LLKLKKLKKNKKKKKKKKKKKKKMKKJKKKKKKKKKKKLLLKMLLKLKKMKKKKKKKKKKKKMKJKKKKKKKKKKKMKKLK]bionic/libc/arch-mips/bionic/setjmp.S/u/raghu/ics_feb29GNU AS 2.21.1%.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@ `%+0p=@9 , FpXB < Vp aR D  bpltp p d  p df !   '.7@MS[FRAMESZA1OFFA0OFFGPOFFRAOFFbotchsetjmp_gp_dispsigblocklongjmperrorabortlongjmpsigsetmask $% % % % I   sigsetjmp.o/ 1331265329 1002 1002 100644 1900 ` ELFP4(<'!'t  '  '<'!'t  '  '02  g? bionic/libc/arch-mips/bionicsigsetjmp.S,MKKLKLLKMMKLKLLK`dbionic/libc/arch-mips/bionic/sigsetjmp.S/u/raghu/ics_feb29GNU AS 2.21.1%d.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@p @%+0p=@9 $FpkB 4VpsdR <  bptp p \ d0  M    0"*104<EFRAMESZGPOFFsigsetjmp_gp_disp_setjmpsetjmpsiglongjmp_longjmplongjmp   $ 0 4 L X  L vfork.o/ 1331265329 1002 1002 100644 1608 ` ELF4P4(<'!A$!($  ! @[; bionic/libc/arch-mips/bionicvfork.S(KKKKKLKLKK\8bionic/libc/arch-mips/bionic/vfork.S/u/raghu/ics_feb29GNU AS 2.21.1%8.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@@ %+0p= 9 Fp_B Vp`R   bpwtp p 8      8vfork_gp_disp__set_errno  ,  H memset.o/ 1331265329 1002 1002 100644 2204 ` ELFP4(0\%( 0 !@$$( 8+H  !@!@(b !#0 %( %(c0`#0! ?0>#8!8,(`$?1#h!`@$@$3 !0  $0#8!8$$< bionic/libc/arch-mips/stringmemset.SKKMKKKKKKLKKKKLKKLK JKKKLKQKKKKNKKKKNLLLRKKLKLPKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKLKMKKKKKKKKKKKKKKKKKNLKLKKKKKKKKMKKKNKKOKMLKKLK] bionic/libc/arch-mips/string/memset.S/u/raghu/ics_feb29GNU AS 2.21.1% .symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@!P'P,pP9h`5 LBp> dRpaN l  ^ppp l  8`  0   L P`_memset16_memset32memset  @ I memcpy.o/ 1331265329 1002 1002 100644 2808 ` ELFP4(<'!#@&H#@!+  (e !&3j#80#0!(! ?08#8!8!@`% @ +$`@```   `$(,048< $(,048<@$+$@$!00  $  $3#8!8$$!8$$0#0!(! ?0H#8!8!@`% @ +$`@```   #$`'(+,/03478;<? $(,048<@$+$@$!00  $  $3#8!8$$!8$$O< bionic/libc/arch-mips/stringmemcpy.S> KKKKKKKKLKKMKLKLKKLKKKNMLLLQLKKKLKKLLKKKKLKKKKKKLKKKKKKKLKKKLKKKKKKLKKKKKKKLKKKKOKLKLKKKKKKKKLKKKKKKKKMKKKNKKKKNKLKKKKMKRKKLKKKKMLLLLLLKKKLKKLLKKKKKKLKKKKKKKKKKKKLKKKKKKKLKKKKKLKKKKKKKKKKKKLKKKKKKKLKKKKOKLKLKKKKKKKKKKKKKKKKLKKKKKKKKMKKKNKKKKKNKLKKKKLK]bionic/libc/arch-mips/string/memcpy.S/u/raghu/ics_feb29GNU AS 2.21.1%.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@ %@+@0p@=X 9 FpxSB VpaR  bp,tp@ p  `       memcpy_gp_dispmemmove  $  I abort.o/ 1331265329 1002 1002 100644 6312 ` ELF0 P4("?P% RU$ > $ >  $ > ' I : ;  : ; I8 I !I/ : ; I  I'  : ;  : ; I<  : ;  : ; I8 .: ; ' I : ; I: ; I4: ; I.? : ; ' @4: ; I4: ; I 1RUX Y 1 U41  4: ; I !1RUX Y "4: ; I? < }w4 xint Vi) sig# h     fhNi&)}  3 dce0#yj#n# iu}&'(c ` %)u#G*}#+}#!"# ind#)# max$)# fns,#  , [)Iset[I L)setLIOL)N h;U)setUI3|Yp2!j3)[4H, 7=O@ >,k`@v sa\,X!``"0"0"0_ bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/asm-genericbionic/libc/stdlibabort.csignal.hsignal.hsignal.hatexit.hunistd.hstdlib.h1+UJ+Jst JsJpJpJA $RMxJ ~Nu$cIK<'!'LHD'! $$ $$ e!( $ !0b@ < ' $@!@B@ - <' $5 K! @ $0' <('( !0$, 0!( $ !0 ! @ $ $   <$ f | |PPL | |PPL|8`R|`abort| $DH(@@DTXHP@DTXHP|__page_size__sighandler_tnext/u/raghu/ics_feb29siginfosigemptysetfn_argsa_sigactionmaskatexit_fncleanup_called__sigaction_handlerdoublesigfillsetfn_ptrsigactioncxa_funcfloat__atexitstd_funcunsigned charsigset_tsa_masklong unsigned intatexitunsigned intfn_dsolong long unsigned intbionic/libc/unistd/abort.csignumshort unsigned intlong long intGNU C 4.4.3charsigdelset__signalfn_t__page_shiftshort intsa_flagslong intabortsigned charsa_handlerlocal_setGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.abort.bss.cleanup_called.2840.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ  npcj  ~|z x p0 h 0 x pJ P p*   pF   pf    p0 0 o  .! w   0| 6?FO[bgqbionic/libc/unistd/abort.ccleanup_called.2840abort_gp_dispmemset__atexitsigprocmaskgetpidkillsigaction_exit !%3:AHOV]dkry!-9GU~-Plw     !- 1 G KZgt  $ P l p    , @ P p        ! % , 0 7 ;         $ ( , 0 4 @ D H L P T ` d h l x | alarm.o/ 1331265329 1002 1002 100644 4168 ` ELFP4(!|@% RU$ > $ > $ > : ; I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I 4: ; I  I4: ; I? < uL-int@S !n4C3a4acd## 45#:6#0|X (,0! it.X .h itp/X 0a0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxbionic/libc/includealarm.cposix_types.htypes.htime.hunistd.h,|HHKLKzGMLyQ<'!'< $! ' (' @4@0<0@'<b$@'<!@' | |P@D | |P@D| 0Tyalarm||__page_sizeitimervaloitvalarmshort unsigned intfloatit_value__kernel_time_tunsigned char__page_shiftlong unsigned int__kernel_suseconds_tdoubletimevalunsigned intlong long unsigned inttime_ttv_usectv_seclong long intGNU C 4.4.3charsuseconds_tshort intit_intervallong intsecs/u/raghu/ics_feb29signed charbionic/libc/unistd/alarm.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.alarm.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pEyZ ( npj  ~|z  p8( `( p4 0p p  (p 8p0g0oo   P5   | "+bionic/libc/unistd/alarm.calarm_gp_dispsetitimer !%3:AHOV]dkry   #- ?_l         ! %    brk.o/ 1331265329 1002 1002 100644 3760 ` ELFP4(! % RU$ > $ >  $ >  I.? : ; ' I@: ; I 4: ; I 4: ; I? < 4: ; I?  Lint_:brk)h)#} 2% 0 v0 !oO bionic/libc/unistdbionic/libc/includebrk.cunistd.h#EOMIHM<'!' !P$!` '!!` ' | hP H | hP Hh (T(@`H\`'brk__bionic_brkhhlong long intunsigned intunsigned charend_datanew_brklong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shift__bionic_brkGNU C 4.4.3charlong intbionic/libc/unistd/brk.cdoubleshort unsigned intsigned char__page_sizefloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.brk.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ   npsj  ~|hz   p, , 0p<I 8Pp+ p  p p00oD    :   h '-bionic/libc/unistd/brk.cbrk_gp_disp__brk__bionic_brk !%3:AHOV]dkry    \  H         $ + / 6 :    creat.o/ 1331265329 1002 1002 100644 3632 ` ELFP4(!`% RU$ > $ > $ > : ; I.? : ; ' I@ : ; I I &I 4: ; I? < 7dintwR0?2).) 0 0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includecreat.cposix_types.htypes.hunistd.hfcntl.h<'!!0 $ |   |   T Ucreatlong long intunsigned intunsigned charmodepathnamebionic/libc/unistd/creat.clong unsigned int/u/raghu/ics_feb29long long unsigned int__kernel_mode_t__page_shiftGNU C 4.4.3charlong intdoublemode_tshort unsigned intsigned char__page_sizefloatshort intcreatGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.creat.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj  ~z  p    p(& pN pj  p p00o    0    "+bionic/libc/unistd/creat.ccreat_gp_dispopen !%3:AHOV]dkry                daemon.o/ 1331265330 1002 1002 100644 4856 ` ELFPP4("4(% RU$ > $ > $ > : ; I.? : ; ' I@: ; I4: ; I U 4: ; I 4: ; I? < 6d int!wR")H/)< )  )Ipid" fd))r 0 0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includedaemon.cposix_types.htypes.hunistd.h vuKabJJopJJz //dev/null<'!'$ 0 D$ $-@!@! @ !(,@!  $&@!  $ @ !  @@  @$! (' $@$$ (' ! $$ (' ! | <P(H | <P(H<( 8TTT 8UUUDL`L\R\``(`0<`daemon<, $<long long intpid_tunsigned intunsigned chardaemonbionic/libc/unistd/daemon.clong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charnochdirlong int__kernel_pid_tdoubleshort unsigned intsigned char__page_sizefloatshort intnocloseGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.daemon.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ  np)j  z2$4<  pp,  ,  p  p  p   p0 @ p0 0o)% ! _    " '<.7<AFLSYbionic/libc/unistd/daemon.c$LC1$LC0daemon_gp_dispforkopendup2closesetsidchdir_exit !%3:AHOV]dkry       ( 0 , 4L d |       0         $ + / 6 : I M T X _ c r v }                  $ eventfd.o/ 1331265330 1002 1002 100644 6256 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscallseventfd.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/eventfd.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 4      0 eventfd_gp_disp__set_errno  $  L ELF,P4(#  % RU$ > $ > : ; I$ > .? : ; ' I@: ; I: ; I 4: ; I  I 4: ; I? < Qint!8eS3j8Z)(E.)Lfd) 3 ret)s-)@h4fd)4 ret )  0 0 bionic/libc/unistdbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/include/syseventfd.c_types.hstdint.heventfd.hunistd.huIKIKuKIK<'!'(,(' $B8$ !` '<'!' $B8$ !` ' | LP D@P D | LP D,@P DL 0T $VW$((W(L(@ $T $U1Ueventfd_writeeventfd_read$L@L@long long intunsigned intunsigned chareventfd_tlong unsigned inteventfd_writelong long unsigned intuint64_teventfd_read/u/raghu/ics_feb29__page_shiftGNU C 4.4.3charlong intdoublebionic/libc/unistd/eventfd.ccountershort unsigned intsigned char__page_sizefloatshort int__uint64_tGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.eventfd_write.rel.text.eventfd_read.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp^p8UZ (! npj ! ~xLz ! @ !p@  !D@ <!p L!p25 !pg( !p  !p0,0$o4 " TM   L ,5;@Hbionic/libc/unistd/eventfd.ceventfd_write_gp_dispwriteeventfd_readread  !%3:AHOV[hov}         $ ;H      , 0  0      $ 3 7 C G T X h l t x           exec.o/ 1331265330 1002 1002 100644 11884 ` ELFP4(*' p(((% RU$ > $ >   $ > : ; I I  : ;  : ; I8 &I .? : ; ' I@ : ; I4: ; I4: ; I4: ; I4: ; I 4: ; I4: ; I  : ;  : ;  UI!I/!I/ : ; I4: ; I? < Ch(int{kZ](0  1# 0#(} cf =A)8&  H&3, :B)F( t H&U(cnt)lp)ln)len)p.) bpcurcbuf._ytiov?_?O  E)! eMargekapgHh(ni) AF)  JargJapL.HM(8M(nN)X *D)k 0arg0ap2H3(n4)M3(0$0 N bionic/libc/unistdbionic/libc/includebionic/libc/kernel/common/linuxbionic/libc/kernel/arch-mips/asm/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includeexec.cunistd.huio.hposix_types.hstdarg.ht@rJ]8fJJfJ wJKIN wNFKMKGHKMKKf twJ=?W8z0KKIKi7tl<<JvGHKt8tEOuoJ,IKHKwxJK0q<LLI?xJQK,LLp<5HKwxJK0=q<<'!' F$ 'PATH/usr/bin:/bin.execvp: : path too long sh/system/bin/sh:<'!'h!ld`\XTPLH!\!Y@ /$@܏!<&!(@ ! ܏ BE(W܏N$FZ$DQ'&'! 8ԯ !(܏!@)@! @&e$$1& ! ܏!Ti($8ŏ? $% $% $$ѯί ͯ,˯0ʯ (ӯ܏!  !(܏!@@! @<֏ W܏ $D!l$hd`\XTPLHp'_($*C $#G$H'4'!0`! !(@¯ Dï! /$܏@ԏx&!(!0 ! Dӏ܏!y ܏!@!@$<ӯ'PG$!@!0B$I $$ 0O$ph#'%D& &܏&D& !(!l$hd`\XTPLHp' $@܏! @ @¯܏@ŏF$$8#' į܏4'<':!0  $Xt!$$<'!' !$4'4ǯ0Ư#!@$c$g$$j$H @ 0Ə#'e¯ f8'!(`KB$`$B$¯ !(`!$ ('$<'!' !$4ǯ&0Ư8'$B$Fc$b$I$@ #0Ǐ'E4' G8'!(@jc$@$c$e$fů !(@!$ ('$<'!' !$4'4ǯ0Ư%!@$c$g$$j$H @ 0Ə#'e¯ f8'!(`KB$`$B$¯ !(`!$ ('$ | 8P D4P DD d  P(DD DP(DD DP(DD D | 8P D4,P DD d  dP(DD DP(DD DP(DD D8 (T (U  `T```x`` LULb0bxbVd4hdddtxaaRaRa4aRapffXfflxRU R U(( TT UUUp8`V(( TT |UUUlxSS4XS(( TT UUUp8`VCexecv1execvpOexeclpexecle execl<8<t(48__page_sizeexeclpchar__builtin_va_listexecliov_lenenvpexecvbionic/libc/unistd/exec.cfloatva_listunsigned charretrylong unsigned inteaccesshort unsigned intdoubleiovecshort int__gnuc_va_listunsigned intlong long unsigned int__kernel_size_tlong long intGNU C 4.4.3name__page_shiftiov_baseexecvpexecleargvenvironmemplong intpath/u/raghu/ics_feb29signed chardoneGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.execv.rodata.str1.4.rel.text.execvp.rel.text.execlp.rel.text.execle.rel.text.execl.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 #((>Lp]^pUZ $( npj &(( ~ 8z & ( 2H T  '@(  \((t t((< ( (p (P( (((p $)(pG  -("p@ -0( 5pX1 -("Cp0lN0Wo g )" 4#    "$P %*(/<4@9>%&C8 IRZahow~bionic/libc/unistd/exec.c$LC7$LC2$LC3$LC4$LC5$LC6$LC0$LC1execv_gp_dispenvironexecveexecvpstrchr__errnostrsepstrlenwritevbcopygetenvstrlcpyexeclpexecleexecl" &@/`01 !%3:AHOV]dkry  !3> B FOY^hm Q\ ` dmw  "-15>HWfk~[ n Z  ## $ %##T 't $x % ( )      *   *( +< D@ Lx ) * ( (4 ,l , ,  0 %, 4| -x  * . ## &## %## $ % ,0 dh   0 h       $ 3 7 F J R V _ c t x                           . 2 9 = D H O S Z ^ e i p t {                        ! % - 1 9 = M Q X \ k o v z                       . 2 9 = D H X \ kow{   ( 0        ( , 0 4 8 < @ D HLfcntl.o/ 1331265330 1002 1002 100644 3416 ` ELFXP4(!(% RU: ; I .? : ; ' I@: ; I4: ; I 4: ; I $ >   ]J(4*<f)D!<fd! cmd!3ap#:arg$ int  bionic/libc/unistd/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includefcntl.cstdarg.h!|GE <'!'$4'40 $(' | <P(D | <P(D<( 0T 0UEfcntl<<bionic/libc/unistd/fcntl.c__gnuc_va_list__builtin_va_listva_listfcntl/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fcntl.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 8 >xLpx^pZ @ x npj  ~<z  p( ( p$F @pj 0 p  8 p H p0i0o1A    5   < "+bionic/libc/unistd/fcntl.cfcntl_gp_disp__fcntl64 !%*6;GR V Z l {           $ 3 7    fnmatch.o/ 1331265330 1002 1002 100644 12128 ` ELFP4(!h% RU$ > $ > $ >  I&I.? : ; ' I : ; I .: ; ' I  : ; I 4: ; I 4: ; I .? : ; ' I@: ; I4: ; I4: ; I : ; 1RUX Y 11RUX Y 1 U41 411X Y 1X Y 4: ; I? < !'=into^!EcE E  j |E e E okE c c2 5/Ea6!6R|6E  8e9jc:dj:-@Pyf` t,<EB8P9{74:{v_ bionic/libc/unistdbionic/libc/includefnmatch.cctype.hfnmatch.h6<JJJLJ J5JJR JtJJIJ0RKIJpJIKKJJKIP򃼁h2MxJoJJgK kJJ,J0^#KI t wJo.4<x t*z @F/JJ(,K^Sd<<Q@F-<'!'d`\XTPLHD@0!X000!?$/$\$-$$]$. $*$$ !h@)J[$#/`$11%D'@ @(!x!N셋$!  $1&!h"@TI1&! R&&,@T! (<40,$8 /$!@(<40,$Y@8!   $!/\ $/H$!$$^$$ j`1!D%+!,`0$@!(3%&h mI!h!(0%/$"Cdd+`\XTPLHD@h'%$d`\XTPLHD@h'" 6f5%`?3'@!*(%*8 $΁΁!h &X@8C*1&%_@!8U+Q/N$!$|^$$%z 1& ! 1+$-,1&! $$6/$($!( !  !0@1&@d!`\XTPLHD@h'ف `%?39z+$5?2dt0!  /$Vd,d!( $!  !0@1&@$$Yd | 0Phh   | 0Phh   T`]`0]0`]`D]D`T]`]@`@P]PT`TxTT] ` ]`]$T$P]P` |U|aRa[<a<H[Ha[lal[a[4a4H[Ha pVVHVPVVlVt|VV|^]^]^^D]]^]P^Pd]d^^] ^H^^$^Pl^t|^^|\0\0R\R x\RRRP\PlRt|RRD\H\ \\\\Pl\t\\|_h_0h0L_Lh<_<h_hP_Ph_h_ h H_Hhh_$h$P_Plht|hhR R04RRHRRHHRPR ,RHR|U^^0U0^^hUh|T|U^U^Ud^U^^U ^,U^^^Pl^t|^^|iditi|titoiiii`it|ii|^^^<l^|^P^ ^H^^^Pl^t|^^ fnmatch@DP\$(HP dtP\$(HP dt<@hxDH/u/raghu/ics_feb29negatestringfloatunsigned charfnmatchshort unsigned int_tolower_tab_doublenewptestunsigned intflagslong long unsigned intbionic/libc/unistd/fnmatch.clong unsigned intpatternlong long intGNU C 4.4.3charshort inttolowerstringstartrangematchlong intsigned charnormal_toupper_tab__ctype_GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fnmatch.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpxn^pZ   npzzj " ~z "P p D `" D p"p8 @ x"p px -p  -p .`p0J0o<  D    &/=bionic/libc/unistd/fnmatch.cfnmatch_gp_disp_tolower_tab_strchr !%,3:AOV]dkry"- 1 5 >H MW \f kv            1 5J N Y bol @ ` 4   \ x         ! % , 0 7 ; B F M Q X \ c g n r y }                              " ) - 4 8 ? C R V ] a h l s w ~                             $ + / 6 : A E L P W [ j n u y                               % ) 0 4 ; ? F J Q U d h o s z ~                             ' + 2 6 = A H L S W f j q u |                              ! % , 0 7 ; B F M Q X \ c g n r                             # ' . 2 9 = D H O S Z ^ e i p t {                             ! ( , 3 7 > B I M T X _ c j n u y                             " & - 1         $ ( , 0 4 8 < @ D H L P T ` d h l p t x |                 fstatfs.o/ 1331265330 1002 1002 100644 4200 ` ELFP4(!`% RU$ > $ > : ; I$ >  : ;  : ; I8 I !I/  : ;  : ; I8 .? : ; ' I@  : ; I: ; I I/intskL40V8pj^*a5SE8eHvalK#w -Q d`' (# =)# *# +# ,# -# .# /#( U0#0 N1#8 y2#@ 3#D  s) fd )  bionic/libc/unistdbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysfstatfs.c_types.hstdint.hposix_types.hvfs.h <'!!0 `$ |   |   T Ufstatfsf_type__padf_filesstat/u/raghu/ics_feb29__kernel_fsid_tf_bsizeuint64_tf_fsidf_bavailfloatstatfsunsigned charf_namelenlong unsigned intf_ffreeshort unsigned intfstatfsf_bfreef_blocksdouble__uint32_tunsigned intlong long unsigned intf_frsizef_sparelong long intGNU C 4.4.3charbionic/libc/unistd/fstatfs.cshort int__uint64_tuint32_tlong intsigned charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fstatfs.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pFZ P np1j  ~$z  p@  `  p&  p @p  Hp Xp00so   T;    &/bionic/libc/unistd/fstatfs.cfstatfs_gp_disp__fstatfs64 !%3:AHOTafsz*8FTbp~                ftime.o/ 1331265330 1002 1002 100644 4268 ` ELFP4(!0% RU$ > $ > $ > : ; I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I  IintWlD4NzV+\3a4a8cd ##G)# )#P #J$#%L#G&E#0'E#.*) tb tv h tz!p  bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxftime.cposix_types.htypes.htime.htimeb.hFN@vHKIMKMFKLKysJ J <'!',(! ' '@b <h%MI5 '8$1#(0 C $, !(0'$ ,$(0' | P0H | P0H0 (T(``Jftimebionic/libc/unistd/ftime.c/u/raghu/ics_feb29ftimeshort unsigned inttimezonetimebfloat__kernel_time_tunsigned charlong unsigned int__kernel_suseconds_ttz_dsttimetz_minuteswesttimedoubletimevalunsigned intlong long unsigned inttime_ttv_usecmillitmtv_seclong long intGNU C 4.4.3chardstflagsuseconds_tshort intlong intsigned charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.ftime.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ 0 npj  ~z  p\, , ,pI 4Pp p  p9 p0Ic0o   8    "+bionic/libc/unistd/ftime.cftime_gp_dispgettimeofday !%3:AHOV]dkry .<LW [ _ q           $ + / 6 :    ftok.o/ 1331265330 1002 1002 100644 4580 ` ELFP4(!<% RU$ > $ > $ > : ; I : ;  : ; I8 I !I/ .? : ; ' I@ : ; I : ; I 4: ; I  I&I4: ; I? < /dint Qnp|&)>h-.h#/#S1Z#30#B40#J6h# 7h#$t9h#(:#,Kh#@ ?h#DZAh#H<Bh#LDh#P.Eh#TcGh#X;Hh#\JZ#`h } _%l   ! id )4 st"0u0 bionic/libc/unistdbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/includeftok.cposix_types.htypes.hstat.hunistd.hipc.h GMIM <'!x'! ' @($%%P'$' | lPH | lPHl ,T $U$H`Xd`3ftokll__page_sizest_atime_nsecstat/u/raghu/ics_feb29st_atime__pad2st_nlinkst_sizest_inost_mtimest_blksizefloatst_rdev__kernel_key_tunsigned charst_blockslong unsigned intst_modeshort unsigned intkey_tdoublebionic/libc/unistd/ftok.cshort intst_ctimeunsigned intlong long unsigned intst_ctime_nsecst_mtime_nsecst_uidlong long intftokGNU C 4.4.3char__page_shiftst_devst_gid__pad0__pad1long intpathsigned charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.ftok.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pQ3Z  npj $ ~`lz , p, D, Tp$] \`p p  p p00o   d/   l )bionic/libc/unistd/ftok.cftok_gp_displstat !%3:AHOV]dkry (6DR`n|     &         ! % 4 8 ? C J N    getcwd.o/ 1331265330 1002 1002 100644 3840 ` ELFP4(! % RU$ > : ; I$ > $ >  I.? : ; ' I@: ; I : ; I 4: ; I? < {_5int;H#~Dbuf  0> ; ; bionic/libc/unistdbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includegetcwd.cunistd.hstddef.h KIK<'!' !B( ! ' | DP H | DP HD (T(<` (UgetcwdDDlong long intsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/unistd/getcwd.cGNU C 4.4.3char__page_sizelong intdoubleshort unsigned intsigned charsizegetcwdfloatshort int__page_shiftunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.getcwd.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 h >xLpx^p Z p  npj P ~Dz X p\, p, pQ Pp p"  pB p0R0Ooaq   0 6   D $-bionic/libc/unistd/getcwd.cgetcwd_gp_disp__getcwd !%1>ELSZahov}               $ + / > B    getdtablesize.o/1331265330 1002 1002 100644 3588 ` ELFP4(!4(% RU$ > $ > $ >  : ;  : ; I8 .? : ; I@4: ; I k;intN)e*+h#,h#)Tr!pg bionic/libc/unistdbionic/libc/kernel/common/linuxgetdtablesize.cresource.hwwK<'!'$$ '@$('  $$ | TP(D | TP(DT( getdtablesizeTTlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intfloatbionic/libc/unistd/getdtablesize.cGNU C 4.4.3charlong intgetdtablesizedoubleshort unsigned intsigned charrlimitshort intrlim_currlim_maxGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.getdtablesize.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxw^pZ  npj |  ~LTz  p( ( p  p$ p4  pT p0d0c ou   \ M   $T 2;Ebionic/libc/unistd/getdtablesize.cgetdtablesize_gp_dispgetrlimitsysconf !%3:AHOV]dkry   t  @           gethostname.o/ 1331265330 1002 1002 100644 4776 ` ELFP4(!|% RU$ > : ; I$ > $ >  I : ;  : ; I8 I !I/ .? : ; ' I@ : ; I 4: ; I 4: ; I U4: ; I4: ; I? < 5int;!HhVB{% &#'#AV(#)#-*#+#  @ .)y !! !0J #|$)s:));;E bionic/libc/unistdbionic/libc/include/sysbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includegethostname.cutsname.hunistd.hstddef.h!(FN@yC<'!H'!' !!@$ Y' ! @*S`! !(@ F$!' $$C |  PT |  PT 4T4aa <U<`c|c@``gethostnameL|__page_sizesysnamesize_t/u/raghu/ics_feb29gethostnamenamelenfloatunsigned charlong unsigned intshort unsigned intutsnamenodenamebuffdoubleversionunsigned intlong long unsigned intresultlong long intGNU C 4.4.3namedomainname__page_shiftshort intbuflenlong intcharsigned charmachinebionic/libc/unistd/gethostname.creleaseGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.gethostname.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p^Z (H npIj p ~<z x0 p4 (4 p\ p" `p  hp/( x0p0W^0 o  S   " .7=DKbionic/libc/unistd/gethostname.cgethostname_gp_dispunamestrlenmemcpy__errno !%1>ELSZahov}  # ,6 ;E JYc hmz, ( L h         ! % , 0 7 ; J N U Y ` d s w ~         getopt_long.o/ 1331265330 1002 1002 100644 25608 ` ELFL8P4(85X`(((% RU$ > $ >   : ;  : ; I8  : ; I8  I &I : ; I $ > ' I II!I/ .: ; ' I : ; I4: ; I.: ; ' I@: ; I: ; I: ; I 4: ; I4: ; I 4: ; I&I.: ; ' : ; I4: ; I.: ;' I@: ;I : ;I !4: ;I"4: ;I#4: ;I $ : ;%1X Y&1' (41)41*1X Y +1RUX Y, U-1RUX Y..? : ; ' I@/4: ; I?  0!14: ; I? < F``%int9R!V /4n6#;E#6=#val?E#  E L   a C 2N)W:zX:#YE#0Twb_px:#_ryE#_wzE#{7# h|7#_bf}#8~E#}#Or# ,#$g#(#,#0_up:#8_urE#<l#@#C_lb#DE#L#P Er }b E } Ex  }  E E } E00 ;@gcdrE0arEbrEctEE$!$MidxEmI iEE /sE@ErEEFEiEjEEEEposE$Ep ='$E^$$$% idx%%E!oli'"(EP"(E#)E$x%X(p&&&&&'X((1(<(G)P)Y)d(o)z)w*\&&'\(&+&&&&&,(1(<)G: )PX )Yv )d (o)z )I *&&'(&-0L&&&&&,H(1(<(G)P} )Y )d (o)z/ )X * &&' (&.EE@ E  $  idx.CE@ E9 L $_ r idx.IE< OE  $ `cEzdE!g  h Mi 'j   k+  SlA  /L/ME/NE/`OE/PE 01A UZ bionic/libc/unistdbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysgetopt_long.cgetopt.hstddef.hposix_types.htypes.hstdio.h<GMGOHxJLv J?IKNu JuJ JLxF n<JJI!J`3J0uJ JLxF n<JJ1 JwJ Jv$ JO*KKM$Nu LNF n<JJh $\$2t-LNFzJJKX wK<>HL<i惊~fJ~MQyJKQyJHLLPuILHL%$ t<zJKOEO~JIgJtRLKqG~~J~4gIKIK~JJ~JgJ~MQyJKQyJtt$~7J$E r4Ki>IKIK ,>IKIK} IKIv<u}~HLMyJQLwJy vHL> vHL>  tu <'!'TPLHD@<840TP&X!S! =$d !@ C$#P 6e$hB $$!! !( !0!  @ ^$&VI%$BhI !)"\@F$ Y`:$0:$:$?$TPLHD@<840X'!! !( !0!  @ g^ $e&%$hF :$ d&& !0T?$PLHD@<840`X',X d@E#V`T (!PLHD@<840hX'hG! $!ߒ! $ ($$ V($ Dv&c$ghQ :$d$&!0 !8a'&!0 !8X ! !@$DT "!ƒ ! $ ($$G(v&c$T?$ ?6߯GX@!((s&tSj @: $%% !07_'^ 88POSIXLY_CORRECT<'!'\XTPLHD@<8!!!!$"xC@t+$Et-L8K5 Plt- $MB@$Bb$.t3@3?[^* `8!@-$'u$I%)$<D#(O#  !P! Y H !P #Xy " xp!p!Y!@͍!H !P#H%` !X lJ%m O̭!h*"!H$` !X lJ%mO̭'% !#x $'^?"^(!8-$Et0@#:$ ! @$p! !(!0% $X!@%]5  0,$ (!  -$0,$ {@($D -$9( '&$s^#(#0i! N#PD!! '^b5@/t$$/t& $$8 +$Ft&S!Ȁ-$t$\!XTPLHD@<8`''C$&$fS4## I`(!P`!(E0!P#"H!x!(E!0@ !P !X#PDh ! -k%. i!p*`B!PCh ! -k%.i$% #pk!.P#: $~f$-&- $J0,!  !(0@,W$J; $D:$@B$q \I%%E $+"b$y$vQ7&Wp :$ u%E& !0a?$^ I$I!n!j7@[fD:$~%! BB$*0SB' *:$%% W$W$׮:$0'?$!k+! p!(!0& !@F+BB$*SB% /$e& !0ޮ:$:$ !(`!XwwB_$'#_G$*@SP!H $-$d¬B@! !Xp*`b"!` !Pk#PFh ! %*Ȏ *hC!PEk%$<'!'$8$Y$ $('<'!'$8$Y$ $('<'!'$!8Y$ $('?unknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s | 0$PXh  0p P`h  @P(D@P(D<P(D | 0$PXh  0Hp P`h  |@P(D@P(D<P(D$ dTd$ hUheLepee e$e tVt4a|aa aa0a tWt  ((0 0$L\`h``` ``$`nnn n n n$nggg(g0g8gp  PTPcLc`cTcT\c\TcPchcc PUP`U`l`lU`UU``p ` dVdee|e|Ve@e@LVL\eeeee PWPfxfxWffWflff   00@@p dlR@R 8RRRRnHpnnR@n|nn HnnxnnnRR R(ZZZ Z<ZdZZ @ZZ\ZZ ZZZT(Z\hThxix|Z|i\T\dZdTZiZ Z<Z@HidZTZ @ZZ\pTpZZT ZZZX,U@HU,YYYYdYYY\YYY Y\]\ ] \\ \<\@H\`H\lp\\\\\ \\ \[ p [  \ p \UTdlRlURpR T p RVdVVpVp VdZZpZ p Zdhoopo p o0[dZSUZ,U,SZpZUdTTpTTdZ0ZpZd]0<]<X^Xl]l^]p]@( 4T 4U 4V 4W@( 4T 4U 4V 4W<( 0T 0U 0Vw 'getopt_long_onlygetopt_longgetoptF optargX opterrj optind| optopt optreset<$p @@<p p $p @@<__sFILEsize_tnoargnargcnargvlong long unsigned int_lbfsize__sFGNU C 4.4.3long long intsigned char_ubufopt_end_basepanonopt_startgetopt_cookiebionic/libc/unistd/getopt_long.clong intncyclelong_optionsrecargchar_flags_blksizeilloptchardoublerecargstring_offsetoff_toptions_readfpos_tunsigned intcyclelen_closelong unsigned int_filenamepermute_argsshort unsigned intnnonoptsgetopt_internaloptreset_writenonopt_startoptcharoptargoptindhas_equalplacematchgetopt_long_onlyswapfloatnoptsunsigned charshort intoptionflagFILEpanonopt_endambigilloptstringoptopt_seekcurrent_argvnonopt_endchar_size_extcstartopterr__kernel_off_tposixly_correcthas_argshort_too/u/raghu/ics_feb29flags_nbufcurrent_argv_lengetopt_longstartparse_long_options__sbufGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.parse_long_options.rodata.str1.4.rel.text.getopt_internal.rel.text.getopt_long_only.rel.text.getopt_long.rel.text.getopt.data.opterr.data.optind.data.optopt.data.nonopt_end.data.nonopt_start.rel.data.rel.local.place.rodata.illoptchar.rodata.recargchar.data.posixly_correct.2378.rodata.ambig.rodata.noarg.rodata.recargstring.rodata.illoptstring.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 F(6>Lp^p Z F06 npA Yj L(6 ~$z MH6 2p  PNp6D!@ Q 6!@ Q 6!< R 6""") ":"Q"M R6g"z0"$T"X"t"("$"p" (RP6&# xR(6(pX$   R`6* p61{ c6,4p1@0 c06.Gp1C 8c60Up020`05io55y A@75 LE:   "$ 5;%H"N(#T"$ap q!"  !"#$%&(*,.0234@'@3<bionic/libc/unistd/getopt_long.cparse_long_optionsplaceilloptstringambignoargrecargstringgetopt_internalposixly_correct.2378nonopt_startnonopt_endilloptcharrecargchar$LC1$LC0_gp_dispoptindstrchrstrncmpstrlenopterroptopt__sFfprintfoptargoptresetgetenvgetopt_long_onlygetopt_longgetopt @A`BC ...!-%,.3.:.A.O.V.].d.k.r.y............,.A.t..........*.F.T..1.< @ D*M.W*\.f*k.u**..*..**......'.2.=.Z.e.p...*.*.*.*.*. **.)*..9*>.K#P.\`*****--0*9*B*K*Y*b*ko--*****).48<*E.P*U.`*e.p*u.*.*.*.*.*.*.*.**/.:*?.J*P.\ a.mr.~.".&.$. % .' !1 .= 'G .T >Y .f :k .x 6} . ; . ? .g 0F55< 6@ H L 7 8 9H :` ; 8 94 :@ ;P <X =T '`'p ;, 9 : < = $$ < = %% 9 >< 9 ; > : < = && ; ;55P #X# 6 ? >   $ /(/0 8 @H L(,<@L `   7   //  7< DP Tp |  //  >\ :  //     7@ @` 0H0X#\ `h 6 tx : ; < = !! ;    : 7, >d :h /p/x  < = "" ;   ( :, /4/ < H <P =L "X"h ; //   655 $55 $55  ( H(L|((( L    ! % , 0 9 = M Q X \ c g n r y }                           ( , 4 8 I M T X _ c j n u y                            # * . =AIM^bimtx !%,07;BFMQX\cgnr #'.29=DHOSZ^eipt{  '+26=APT[_fjqu| &*15<@GKRV]ahlsw~  $+/6:AELPW[bfmqx| "&-18<CGNRY]dhw{      ' + : > E I X \ c g v z                            $ + / 6 : I M T X _ c j n }                            / 3 : > E I X \ c g n r y }                     % ) 9 = L P _ c r v             (0  $048<HLPT` d hlptx|getpgrp.o/ 1331265330 1002 1002 100644 3324 ` ELFLP4(% RU$ > $ > $ > : ; I.? : ; ' I@ 4: ; I? < xAint!T/")H=0k0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includegetpgrp.cposix_types.htypes.hunistd.h <'! ! |   |  getpgrplong long intpid_tunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3bionic/libc/unistd/getpgrp.ccharlong int__kernel_pid_tdoubleshort unsigned intsigned char__page_sizefloatshort intgetpgrpGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.getpgrp.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxj^pZ  npj  ~tz  p    p p  p  p00"o4D$ p  7    &/bionic/libc/unistd/getpgrp.cgetpgrp_gp_dispgetpgid !%3:AHOV]dkry          getpriority.o/ 1331265330 1002 1002 100644 3624 ` ELFP4(! % RU$ > $ > $ > .? : ; ' I@: ; I: ; I4: ; Ie;intN)/)< ) who )3")F}] bionic/libc/unistdbionic/libc/include/sysgetpriority.cresource.h uK <'!' @$#b ' | <P D | <P D< $T $U,4Rgetpriority<<long long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/unistd/getpriority.cwhichgetpriorityGNU C 4.4.3charresultlong intdoubleshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.getpriority.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxy^pZ  npj x  ~D<z  p( ( pY Pp)" pK  pk p0{0j o|   P E   "< .7bionic/libc/unistd/getpriority.cgetpriority_gp_disp__getpriority !%3:AHOV]dkry      j          $ 3 7 F J    getpt.o/ 1331265330 1002 1002 100644 3284 ` ELFP4( 0% RU$ > $ > $ > .? : ; ' I@ 4: ; I? < Nint!.a<) 0x0gQ bionic/libc/unistdbionic/libc/includegetpt.cunistd.h/dev/ptmx<'!$ $ |  |   getpt long long intshort unsigned intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3bionic/libc/unistd/getpt.clong intdoublegetptsigned char__page_sizefloatshort intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.getpt.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx]^pZ  npkj d  z2   l (p(  H  ph p  p p00o  l 5    ! '0bionic/libc/unistd/getpt.c$LC0getpt_gp_dispopen !%3:AHOV]dkry  ^         initgroups.o/ 1331265330 1002 1002 100644 4920 ` ELFP4(!H% RU$ > $ > $ > : ; I.? : ; ' I@: ; I4: ; I 4: ; I 4: ; I : ;   I &II!I/ 4: ; I? < W3pint%*^$@0 ;N)S#!X#J%*T &:s ret') () 45t % :} 00 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeinitgroups.cposix_types.htypes.hunistd.hgrp.h#,HLLzP J?q=y<'!'D@<840$''!0!8@! !@! !( 0( ! (D@<840H'   @!@! !(`!8@ !0@A$$ | $PHX | $PHX TTTdd TUTcc`aaRaRatRRRR@ttPP[initgroupslong long intunsigned intnumgroupsunsigned charbionic/libc/unistd/initgroups.cusergrouplong unsigned int/u/raghu/ics_feb29long long unsigned intgroups0__page_shiftgroupsGNU C 4.4.3charlong intdoubleinitgroupsshort unsigned intsigned char__page_sizegid_t__kernel_gid32_tfloatshort intEXITGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.initgroups.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pO[Z (0 npj X ~z `8 p8 8 p) `p)! pJ  pj (p0z90 o  X   ! ,5BLQbionic/libc/unistd/initgroups.cinitgroups_gp_dispgetgrouplistsetgroupsfreemalloc !%3:AHOV]dkry         AN , ` x          ! % , 0 7 ; J N U Y ` d s w ~                             isatty.o/ 1331265330 1002 1002 100644 4084 ` ELFPP4(!dH% RU$ > $ > $ > : ; I : ;  : ; I8 I !I/ .: ; ' I  : ; I  I .? : ; ' I@: ; I4: ; I 1X Y 14: ; I? <  int1c/ x]>J0'(##B# # "### } S1)3 fd1) s13  q)8fd")!=$P(&)00 bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asmisatty.ctermios.htermbits.hunistd.h"tt<'!'D'  T$DB,H' | 8PHD | 8PHD8 (T9isatty88__page_size/u/raghu/ics_feb29c_oflagtermiosshort unsigned intc_cflagtcflag_ttcgetattrfloatunsigned charisattylong unsigned intc_lflagc_ccdoubleunsigned intlong long unsigned intc_iflaglong long intGNU C 4.4.3charc_line__page_shiftshort intcc_tlong intbionic/libc/unistd/isatty.csigned chartermGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.isatty.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 ,>xLpx^pqZ 40 npj d ~8z l p( ,( pT4 0p p  p p0B0o)9x    3   8 $-bionic/libc/unistd/isatty.cisatty_gp_dispioctl !%3:AHOV]dkry;F J N ` ew {          ! %    issetugid.o/ 1331265330 1002 1002 100644 3052 ` ELFP4(% RU$ > $ > $ > .? : ; ' I@ 4: ; I? < r;intN)~_)0e0kU bionic/libc/unistdbionic/libc/includeissetugid.cunistd.h! |   |  issetugidlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_sizefloatshort intissetugidbionic/libc/unistd/issetugid.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.issetugid.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx]^pZ  npoj  zp  (  pH  ph  p p00oh P  *     bionic/libc/unistd/issetugid.cissetugid !%3:AHOV]dkry  b       killpg.o/ 1331265330 1002 1002 100644 3752 ` ELF P4(! % RU$ > $ > $ > : ; I.? : ; ' I@: ; I: ; I/]int!pK")H})X& sig&)> bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includekillpg.cposix_types.htypes.hsignal.h&uIF <'!'$#   ' $C '$ | XP D | XP DX ,T4@T 4U4@UkillpgXXlong long intpid_tunsigned intunsigned charbionic/libc/unistd/killpg.clong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3pgidlong int__kernel_pid_tdoubleshort unsigned intsigned charkillpgfloatshort intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.killpg.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxw^pZ   npj  ~Xz  p( ( p8\ `p p  p p00o4    :   X $-2bionic/libc/unistd/killpg.ckillpg_gp_dispkill__errno !%3:AHOV]dkry       4         $ + / > B I M    lseek64.o/ 1331265330 1002 1002 100644 3924 ` ELFP4(!0% RU$ > $ > $ > : ; I.? : ; ' I@: ; I: ; I 4: ; I 4: ; I? < Cwint#`1FSEFlfd ) off 3 ) "K 0 0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includelseek64.cposix_types.htypes.hunistd.h wKq<'!',@!(  '@ $,!!0',$$!!0' | lP0D | lP0Dl0 0T 0VW<Pplseek64lllong long intlseek64unsigned intunsigned charlong unsigned intbionic/libc/unistd/lseek64.clong long unsigned int/u/raghu/ics_feb29char__page_shiftGNU C 4.4.3__page_sizelong intshort intdoubleshort unsigned intsigned charoff64_tfloatloff_twhenceresult__kernel_loff_tGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.lseek64.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np,j  ~lz  pd( ( p_ Pp ,p1  4pQ Dp0a 0o   d 8   l &/bionic/libc/unistd/lseek64.clseek64_gp_disp__llseek !%3:AHOV]dkry                $ 3 7 K O    mmap.o/ 1331265330 1002 1002 100644 4472 ` ELFP4(! % RU$ > : ; I$ >  $ > .? : ; ' I@: ; I : ; I 4: ; I? < "@int;S./h j# #0>#)\(#)z fd#)o#l ; v;4 bionic/libc/unistdbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/include/sysmmap.cunistd.hstddef.hmman.h#tKI~E <'!'4C0`004  ' $D '$ | hP D | hP Dh DTDPT DUDPU DVDPV DWDPW ((DXDPXPh ((,R,DDPRPh&mmaphhlong long intsize_tmmapunsigned charflagslong unsigned int/u/raghu/ics_feb29long long unsigned intaddroffset__page_shiftbionic/libc/unistd/mmap.cGNU C 4.4.3char__page_sizelong intdoubleshort unsigned intsigned charsizefloatprotshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.mmap.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p &Z   np/8j  ~hhz   p( ( p  0p0 PpK  Xpk hp0{0o   |9   h )1bionic/libc/unistd/mmap.cmmap_gp_disp__mmap2__errno !%1>ELSZahov}         " , D         $ + / > B I M \ ` g k z ~                        nice.o/ 1331265330 1002 1002 100644 3508 ` ELF@P4(!t % RU$ > $ > $ > .? : ; ' I@: ; I4: ; Is@int S.)T) j )L0 bionic/libc/unistdnice.cIK<'!'!!( ! !0P! !(  ' | TP H | TP HT (T(D`niceTTlong long intniceunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intpriorityGNU C 4.4.3charlong intdoubleshort unsigned intsigned charbionic/libc/unistd/nice.cfloatshort intincrementGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.nice.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 < >xLpxh^pZ D  npPj  ~Tz   p@, 4 l, D p> L @p p  p p0!0o*h    A   T )5bionic/libc/unistd/nice.cnice_gp_dispgetprioritysetpriority !%3:AHOV]dkry    =  8         $ + /    open.o/ 1331265330 1002 1002 100644 4244 ` ELFP4(!(% RU$ > $ >  $ > : ; I.? : ; ' I@: ; I  4: ; I  4: ; I  I&I4: ; I? < ;]int .pK(90?(}f.)`8" 3")> .$ DH A*  00tS bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sys/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includeopen.cposix_types.htypes.hstdarg.hunistd.hfcntl.h"wLEO N <'!'$ 404@0 !0$('4' $(' | `P(D | `P(D`( 8TDTT 8UDTU?open``long long intopenunsigned intunsigned charmodeflags__builtin_va_listlong unsigned int/u/raghu/ics_feb29long long unsigned int__kernel_mode_tbionic/libc/unistd/open.c__page_shiftGNU C 4.4.3charlong intva_listdoublemode_tshort unsigned intsigned char__page_size__gnuc_va_listfloatshort intpathnameargsGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.open.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p6?Z ( npuxj  ~`z   pP( x( p\ `p lp  tp7 p0GF0o   l0   ` )bionic/libc/unistd/open.copen_gp_disp__open !%3:AHOV]dkry       %2` , H         $ + / > B I M    openat.o/ 1331265330 1002 1002 100644 4356 ` ELFP4(!(% RU$ > $ >  $ > : ; I.? : ; ' I@: ; I : ; I  4: ; I  4: ; I  I&I4: ; I? < I.XintkF 40?(}f'/)\'fd") "'> .")\ )$ @D "*-00tU bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sys/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includeopenat.cposix_types.htypes.hstdarg.hunistd.hfcntl.h"wL N <'!'$ 40@4 !8$('8' $(' | \P(D | \P(D\( 4T@PT 4U@PU 4V@PVMopenat\\long long intunsigned intunsigned charmodeflags__builtin_va_listlong unsigned int/u/raghu/ics_feb29long long unsigned int__kernel_mode_t__page_shiftGNU C 4.4.3charlong intva_listdoubleshort unsigned intsigned char__page_sizemode_t__gnuc_va_listfloatshort intpathnameargsopenatbionic/libc/unistd/openat.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.openat.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pEMZ 0 npxj  ~ \z $  ph( D( Tpz \p2 pO  po p0J0o,   6   \ $-bionic/libc/unistd/openat.copenat_gp_disp__openat !%3:AHOV]dkry        3@b ( D         $ + / > B I M \ ` g k    opendir.o/ 1331265330 1002 1002 100644 15852 ` ELF"P4(0-((@((0@% RU$ > : ; I$ > $ >  : ;  : ; I8 I !I/ : ; I  : ;   I &I : ; 5I.? : ; ' I@ : ; I : ; I4: ; I&.? : ; ' @.? : ; ' I@4: ; I.: ; ' I : ; I4: ; I : ;  : ; I4: ; I1RUX Y 1! U"41# 1$ %41& : ; '' I(I)&I*4: ; I? < 6;int,;k"6i8{D/7^8pX56#17#8W#9I#:#" DIR=- DIRx=')#(0#)#*# +#  )*#)[+  )F),.T "_G)$DaDbDd1Kd2K J nEp&zdirFQD)tddirrc)x\dir\^Badrcb)C)$dir K3entx)\)zx !("#4$%ApfdK)dirM@ I3@dir5i&iFp3Bdir@P !x"#`!%H)NTdirفo TByۚd)]Z߳de߳K7)-!K K')j(j p)X Z')(( j *;*;M bionic/libc/unistd/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includeopendir.cstddef.h_types.hstdint.hdirent.hpthread.hunistd.h.KuKMLHL8HKFNHLxx#J]J#R0t <J;uK>KKIKGKKK3IK= HKKut,MPxxJoJIKJP$KIu@(JT$K t8yJ@u <fJfJfJ?Ll0KtZJ&Jp,<'!$ $<'!'$  $! ! !( !0! $  ('<'!'$ ! $ & !@ ! $!  ('<'!'<840,($ !! !V  &@ ! `@@$202G&0,$!2x &+@7$&!( F&@ #R P? ! `<!840,($ @'  $K P V&!(  h$$A Cr!(  h$@@ &!( V ! <'!'$ ! x$@!@Q@@ D$ !($! ('<'!'$ ! x$@!@!  < @ & !($! (' ! !<'!',($  $! ! `%@$202G&0,<!2x &+@48$&!( F&2@ #R ! `,! ($ 0'&$!(  h$A Cr! ! `,! ($ 0'@ ! $K<'!'<840,($ !! ![@!@!!! ! *@!@`!` ! @C9 $!@& &hgf ec$X! +ji ! &@!@ ! !8! !( $Q<!840,($ @' &!  (@!@ $@!@$<$!840,($ @' ! $ |   $pP(LtP(L,$P@d pP(LP(L$P0X,P@d  |   $$4pP(LTtP(L,t$P@d pP(LP(L$P0X, P@d  T Up( ,T,h`t( (T(l`Dha$ LTL`4\`` LULe4$e LVLd4$d\f4$f,`\`$`R4@RLXRRRp( (T(da( (T(|aa4<`<LRL``0 8T8`D`L`Pa@aLaPR R(RLlR LT LULtbbb LVLpccc LWL`gggPXeXdRdheeed|```d|d|R d ,R,ldddS`xaaRaa\dfffdirfdalphasortQrewinddirzclosedirreaddir_rfdopendiropendirreaddirscandir\$pt$px4Lx4L@L@LL`$pt$presult_DIR_next_DIR_fduint64_tshort intsize_treaddirbionic/libc/unistd/opendir.cdirentalphasortExitrewinddirsave_errnoretvalint64_tvalue_DIR_buffde_list_newd_reclensigned charopendird_typefloatlong long intlong int__int64_td_inode_listfdopendirn_elementryunsigned chardirpd_offde_list_sizelong long unsigned intpthread_mutex_tunsigned int_readdir_unlocked_DIR_availreaddir_r__page_size/u/raghu/ics_feb29charscandirshort unsigned int__page_shiftcompar__uint64_td_namelong unsigned int_DIR_locknamelistdirfddoubleGNU C 4.4.3filterdirpathclosedirthis_deGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.dirfd.rel.text.alphasort.rel.text.rewinddir.rel.text.closedir.rel.text.readdir_r.rel.text.fdopendir.rel.text.opendir.rel.text.readdir.rel.text.scandir.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 $.H.>xLpx ^pZ l.. np@ j 2H. zX ` $ 2. p 2(. t 3(.h $ 43.p 3 . 30. $4P.  t4X.#p 8 4.4X80 \5H. BpV> 5 ."QpM ;.$epk`a ;P.&xp t <.(p0b0M o_ o )p/  -    "$&(*+, $$.7>pH[avt$p bionic/libc/unistd/opendir.cdirfdalphasort_gp_dispstrcmprewinddirpthread_mutex_locklseekpthread_mutex_unlockclosedirclosepthread_mutex_destroyfreereaddir_r__errnomemchrgetdentsmemcpyfdopendirmallocpthread_mutex_initopendiropenreaddirscandirreallocqsort @!`%).134 !%1>ELSZ_lq~;IWes    +SZ ^ bu|    ',6FPU_h lx    +/3FKU^bn| %/4>CHqZ j {   -P  "< #T $$ &8 'P (8 *T *h " * + * $4 *L *d *| $ , * , * * * - /< 0 /< 2X 0 (, " + $ , * $` *| $8 1d 3 / 5 / 3  %8 6 ( $( 48 TX tx   ( 8 X x     & * 2 6 F J Q U d h p t                        $ 3 7 > B I M \ ` g k z ~                 $,0@DKOVZimtx %)04;?NRZ^os ")-48?CJN]ahlsw-18<CG   ( 0 8@HP        ( , 0 4 8 < @ D PTX\`dhlx|           pathconf.o/ 1331265330 1002 1002 100644 7176 ` ELFP4('$% RU$ > $ > : ; I$ >  : ;  : ; I8 I !I/  : ;  : ; I8 .: ; ' I  : ; I4: ; I 4: ; I I&I.? : ; ' I@: ; I4: ; I hint|40Z8p2ot5SV8eHvalK#w 4Q u`' (# D)# I*# +# ),# -# .# /#( f0#0 _1#8 L2#@ R3#D  6w s6y;(STsIeRBSFX{QF3JFS1NTFSnnG)   Tw sTZ] Z#maxZ)#Z8S}S}h$sIeRT}nnd)8  w s qw- sqt= E=(SJADMNTFS/nnz)= -*:w )!)4bufret);w ]~)bufret)m bionic/libc/unistdbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/syspathconf.c_types.hstdint.hposix_types.hvfs.hpathconf.hHL7=FLp^pZ H% npqj (% ~ z 80%  P h%p  0%| P 8%p H  % H %p\  %p - %pC ( %%pk !  %3p0 >0r Go  W& R   !"#  )2:B Kbionic/libc/unistd/pathconf.cfpathconf_gp_dispfstatfs__errnopathconfstatfs  !%3:AHOTafsz*8FTbp~A^DO S W`joy   4  @ < t       $ ( , 0 4 8 < @ D H L  @ < t       $ ( , 0 4 8 < @ D H L   0 4  4     ! % 4 8 ? C J N ] a i m ~              perror.o/ 1331265330 1002 1002 100644 4104 ` ELFP4("t(% RU$ > $ > $ > .? : ; ' @: ; I4: ; I  I &I I !I/ 4: ; I? < y;intN)e  !"} } 0 l0wR bionic/libc/unistdbionic/libc/includeperror.cunistd.h (((u: <'!'$  !D'!( $  ! !( !0@ $$$ $ ! !(!0@ $$E$ $$ (' | PL | PL ,T,aperrorlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intperror__page_shiftGNU C 4.4.3bionic/libc/unistd/perror.ccharlong intdoubleshort unsigned intsigned char__page_sizefloatshort intprefixbuffGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.perror.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 0 >xLpx^pZ 8 np {j  z2 p px0  0  p? @ p  p4   pT  p0d 0aos% !  W    " '.7?JQbionic/libc/unistd/perror.c$LC0$LC1perror_gp_disp__errnostrerror_rstrlenwrite !%3:AHOV]dkry    _  4 P d  |            ! % , 0    popen.o/ 1331265330 1002 1002 100644 9372 ` ELFP4(%"@P% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/  : ; .? : ;' I@: ; I4: ; I4: ; I: ; I4: ; I  U5I4: ; I? < 4: ;I? < x intW?9iw`rc/ a"")CyHLNW X# Y)#>Tw _px# _ry)# _wz)# 1{E# |E# _bf}# &~)# }# '# G#$ g#( 8#, #0 _up#8 _ur)#< #@ I#C _lb#D )#L #P )' } )G } )- g } )M ) }  ) m>>pid - .# fp/# pid0#8)Hoiop!cur4])pid9 O646Zcur8 iop9:Lpid;<TT)/13M0S0) bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includepopen.cposix_types.htypes.hstdio.hunistd.h4zJpJJr$JI?Kz$ 6$HH}OLC$(KIm= IK@LIKHKHOsjA<'!'<840,($ <D!d!<$840,($ @' '$$!(@ !0!@Q D ! $<840,($ @'sh-c/system/bin/sh<'!'LHD@(%$r$$(!,C0w$D @ !$EL!HD@P'8  $/@88 '$@8 8 $!@"K8D@r$+  M.ą 81 8M$ 8! @8 ! !   Lr$-/  7,& $' $   !@'QǬ$   $  $   !(  | (HP@`PPP | (HP@`@PPPH T<`4`<H`te e<He<XtffRf<Hf TTTl`ltTt`|`` ,`d` tUUU UdlUxU|HHl`t|``,d`|aa,R<TR|RaR  R dadlRlxaxRdaa#|pcloseopopen$Hdx Henvironpstat__sbuf_ext_offset__kernel_pid_t_flags_writeshort int_nbufprogramsigned charfloatlong long intlong int_blksize_close/u/raghu/ics_feb29unsigned char_readpclose__isthreadedpopenlong long unsigned intpdesunsigned intargplast__page_size_cookiepidlist_base_lbfsizechartypeshort unsigned intfpos_t__page_shiftlong unsigned intdoublepid_t__kernel_off_toff_t_seek_fileGNU C 4.4.3pcurFILE_ubuf_sizenext__sFILEbionic/libc/unistd/popen.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.pclose.rodata.str1.4.rel.text.popen.bss.pidlist.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 #>LpM^p|Z X# npaj D# ~ Hz TP# 2T l  #D pD \ # \ #p  @#p' ,$#p( 4$#p8  L$P#p01)02o-=BH$ (   $). !3H :CJRZ_elqvbionic/libc/unistd/popen.cpidlist$LC0$LC1$LC2pclose_gp_dispfclosewaitpid__errnofreepopenmallocpipefork__isthreadedclosefilenoenvironexecve_exitfdopendup2 " !%3:AHOV]dkry)7Sao}   .=BLQ[jq}  0< ATan  4 8 T `   !D $ 0( 4\ h # $ %   &  'D (d !| ' ' ! ' ) *  + ,( '< D `  - ' - ' @D  D     ! % 4 8 ? C J N ] a h l s w                         & * 1 5 < @ G K Z ^ e i p t {                          % ) 0 4 ; ? F J Q U \ ` g k r v }               $ ( , pread.o/ 1331265330 1002 1002 100644 4096 ` ELFLP4(!(% RU$ > : ; I$ >  $ > : ;I.? : ; ' I@ : ; I : ; I 4: ; I? < &eint;;#R l l5CX8 fd) buf3 0F ^Y ; x;nU bionic/libc/unistd/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/syspread.cstddef.hstdint.hposix_types.htypes.hunistd.hu= <'!'$ $(' | 8P(D | 8P(D8( ,T ,U ,V ,W*pread88long long intsize_tunsigned charlong unsigned intoff_tlong long unsigned intfloatpreadoffset/u/raghu/ics_feb29__page_shiftGNU C 4.4.3charssize_tlong intnbytesdoubleshort unsigned intsigned char__page_sizebionic/libc/unistd/pread.cshort intunsigned int__kernel_off_tGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.pread.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 (>xLpx^p*Z 0 np@rj @ ~8z H p( `( pp<l x`p p  p p0!0o'7t    3   8 "+bionic/libc/unistd/pread.cpread_gp_disppread64 !%1>ELSZahov}        b          $ 3 7 F J Y ]    pselect.o/ 1331265330 1002 1002 100644 5560 ` ELF P4(!?X% RU$ > $ > $ >  : ;  : ; I8 I!I/ : ; I  : ;  : ; I8 .? : ; ' I@ : ; I: ; I4: ; I 4: ; I4: ; I  I&I&IF! inturQ;[\N d!#h} 5" b3a 4a Ec d S #a# 7 ##N sigN#h^} 7 & 3))$# n!)!!#J!#s!#-")m"8 $^P%)1tv&H&CDi/S>^ bionic/libc/unistdbionic/libc/kernel/common/linuxbionic/libc/kernel/arch-mips/asmbionic/libc/include/syspselect.cposix_types.hposix_types.htypes.htime.hsignal.hselect.h",uIHLHL J?v$Iu<'!'TPLHD@l!!! h8$!( ('8-b <h%MI5 0xLpx ^pJZ  npj  ~$z ( p8 @8 pxb p p  p p0(0 o  0  F   $ &/?bionic/libc/unistd/pselect.cpselect_gp_disppthread_sigmaskselect !%3:AHOV]dkry)_jv           0 D          ! % , 0 7 ; J N U Y ` d s w ~                         " 1 5 D H O S    ptsname.o/ 1331265330 1002 1002 100644 4072 ` ELFP4(# (% RU$ > $ > $ >  I.? : ; ' I@: ; I4: ; I I !I/ 4: ; I? < mC# intV1"fd"E $Lp% }? L L .L bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asmptsname.cunistd.hioctl.h"FNIK /dev/pts/%u<'!'$ @<0T4 '@$! ('&$ @$$& (' | P(H | P(H( 0Tptsnamelong long intptsnameunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/unistd/ptsname.c__invalid_size_argument_for_IOC__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_sizefloatshort intbuffpty_numGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.ptsname.bss.buff.2568.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 8!>xLpx^pZ @! np j (! z2  0H!P@pP, x!|, !p3 0!p !p  !p !p0) 0I%o[k5 "  M   @( -5>Dbionic/libc/unistd/ptsname.cbuff.2568$LC0ptsname_gp_dispioctlsnprintf !%,3:AOV]dkry     T \ P `L p         $    ptsname_r.o/ 1331265330 1002 1002 100644 4968 ` ELF P4("p% RU$ > $ > $ > : ; I I.? : ; ' I@: ; I : ; I 4: ; I 4: ; I 4: ; I I!I/ 4: ; I? < C)ZintmH"L#Efd#E!buf#? #~ *%L %& len'E }? LL.LT$ bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asm/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includeptsname_r.cunistd.hioctl.hstddef.h#$O=Kut==t=/dev/pts/%u<'!'lhd`!-!@<0T4 '@'$!  @$*R@! !(  F$!lhd`p' $D$ "$G$ $C$ | PpP | PpP DTT 8U8``U` 0V0pbbbb\pRRGptsname_rbuflenunsigned intunsigned charsize_tbionic/libc/unistd/ptsname_r.clong unsigned int/u/raghu/ics_feb29long long unsigned int__invalid_size_argument_for_IOC__page_shiftGNU C 4.4.3charlong intlong long intptsname_rdoubleshort unsigned intsigned char__page_sizefloatshort intbuffpty_numGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.ptsname_r.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pJGZ  npXj  z2  P p0  $0  pT   pQ  @ pq  H p X p020o(p! @V    %/8>GNbionic/libc/unistd/ptsname_r.c$LC0ptsname_r_gp_dispioctlsnprintfmemcpy__errno !%,3:AOV]dkry         -:1 0 P L \x           ! % , 0 ? C J N U Y ` d k o ~                     pwrite.o/ 1331265330 1002 1002 100644 4116 ` ELF\P4(!(% RU$ > : ; I$ > $ > : ;I.? : ; ' I@: ; I : ; I  I & 4: ; I? < +yYint;;# l l5C8 fd) buf 3 0F RY  ; l;oV bionic/libc/unistd/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/syspwrite.cstddef.hstdint.hposix_types.htypes.hunistd.hu= <'!'$ $(' | 8P(D | 8P(D8( ,T ,U ,V ,W/pwrite88long long intsize_tunsigned charlong unsigned intoff_tlong long unsigned intoffset/u/raghu/ics_feb29__page_shiftGNU C 4.4.3charssize_tlong intnbytesdoubleshort unsigned intsigned char__page_sizefloatpwriteshort intunsigned int__kernel_off_tbionic/libc/unistd/pwrite.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.pwrite.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 <>xLpx^p/Z D npLsj T ~8z \ p( t ( pHl `p p  p p0#0$o6F   6   8 $-bionic/libc/unistd/pwrite.cpwrite_gp_disppwrite64 !%1>ELSZahov}       "c          $ 3 7 F J Y ]    raise.o/ 1331265330 1002 1002 100644 3532 ` ELFlP4(!4(% RU$ > $ > $ > .? : ; ' I@: ; I4: ; I? < )]intpK{)@D) 00w] bionic/libc/unistdbionic/libc/includeraise.cunistd.hsignal.huuI <'!'$ $! @ (' | @P(D | @P(D@( Traise@@long long intunsigned intunsigned charbionic/libc/unistd/raise.csignumlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intshort intdoubleshort unsigned intsigned char__page_sizefloatraiseGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.raise.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 \ >xLpxn^pZ d  np{j 4  ~0@z <  pp( \ ( l p3 t 0p p  p/ p0?05oGW   $ 7   @ "+2bionic/libc/unistd/raise.craise_gp_dispgettidkill !%3:AHOV]dkry    j  ,         $    reboot.o/ 1331265330 1002 1002 100644 3456 ` ELFPP4(!% RU$ > $ > $ > .? : ; ' I@ : ; I4: ; I? < ~Gint"Z5,),0)0q0v bionic/libc/unistdbionic/libc/includebionic/libc/include/sysreboot.cunistd.hreboot.hK<'!!0(<<ބ4i4 !8 |  , |  , T,Vreboot,,long long intunsigned intrebootunsigned charmodelong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_sizebionic/libc/unistd/reboot.cfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.reboot.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 0 >xLpxn^pZ 8  npj  ~H,z   pt    0 p 8 p X p  ` p p p00o'7x    6   , $-bionic/libc/unistd/reboot.creboot_gp_disp__reboot !%3:AHOV]dkry               recv.o/ 1331265330 1002 1002 100644 3892 ` ELFP4(!(% RU$ > : ; I$ >  $ > : ;I.? : ; ' I@ : ; I : ; I~Gint;Z5q l)X4 .) buf3 w0F #;Y/ bionic/libc/unistd/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includebionic/libc/include/sysrecv.cstddef.hstdint.hsocket.hu <'!'$ $(' | 4P(D | 4P(D4( (T (U (V (Wrecv44long long intsize_tunsigned charflagsrecvsocketlong unsigned int/u/raghu/ics_feb29long long unsigned intfloatbuflenGNU C 4.4.3charssize_tlong intdoubleshort unsigned intsigned charbionic/libc/unistd/recv.cshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.recv.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 t >xLpx^pZ |  np3j t ~04z | pd( ( pl `p  p;  p[ $p0k0bot   @ 2   4 )bionic/libc/unistd/recv.crecv_gp_disprecvfrom !%1>ELSZahov}       $          $ 3 7 F J Y ]    sbrk.o/ 1331265330 1002 1002 100644 4356 ` ELFP4(!(% RU: ; I$ > $ >  $ >  I.? : ; ' I@ : ; I 4: ; I 4: ; I 4: ; I 4: ; I? < 4: ; I?  )gC4intzU %) 'I end(g M) ; ;#  bionic/libc/unistdbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includesbrk.cunistd.hstddef.h%$HLLIKzBEOp<<'!'$ "!@!R$$$B!P ! $C+P$"!@ ('  $D$$ (' ! " | P(P | P(P( 4T4H``@xbbH```(sbrk __bionic_brklong long intunsigned intunsigned charbionic/libc/unistd/sbrk.cptrdiff_tnew_brklong unsigned int/u/raghu/ics_feb29long long unsigned intsbrk__page_shift__bionic_brkGNU C 4.4.3charstartlong intdoubleshort unsigned intsigned char__page_sizefloatshort intincrementGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sbrk.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p?Z  np\$j  ~z 0 pL0 4|0 Dp Lp1, p]  p} p00o   D    )6<bionic/libc/unistd/sbrk.csbrk_gp_disp__bionic_brk__brk__errno !%*>ELSZahov}        $ @           $ + / 6 : I M T X g k r v    send.o/ 1331265330 1002 1002 100644 3904 ` ELFP4(!(% RU$ > : ; I$ > $ > : ;I.? : ; ' I@: ; I : ; I  I &0\int;oJ lW4)) buf30F#;Y  / bionic/libc/unistd/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includebionic/libc/include/syssend.cstddef.hstdint.hsocket.hu <'!'$ $(' | 4P(D | 4P(D4( (T (U (V (Wsend44long long intsize_tunsigned charflagssocketbionic/libc/unistd/send.clong unsigned int/u/raghu/ics_feb29long long unsigned intbuflenGNU C 4.4.3sendssize_tlong intdoubleshort unsigned intsigned charfloatshort intunsigned intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.send.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p Z  np 3j  ~@4z  pt( ( pl `p0 pK  pk 0p0{0ro   P 0   4 )bionic/libc/unistd/send.csend_gp_dispsendto !%1>ELSZahov}       $          $ 3 7 F J Y ]    setegid.o/ 1331265330 1002 1002 100644 3548 ` ELFP4(!p% RU$ > $ > $ > : ; I.? : ; ' I@ : ; I4: ; I? < .]intpK@0;U) )00 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesetegid.cposix_types.htypes.hunistd.h<'!!($ $ |  |   Tsetegid long long intunsigned intunsigned charegidbionic/libc/unistd/setegid.clong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_sizegid_t__kernel_gid32_tfloatsetegidshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.setegid.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx{^pZ  npj l  ~ z t  p    p p p-  pM p0]0lo~   P 9     &/bionic/libc/unistd/setegid.csetegid_gp_dispsetresgid !%3:AHOV]dkry             setuid.o/ 1331265330 1002 1002 100644 3724 ` ELFP4(! % RU$ > $ > $ > : ; I.? : ; ' I@: ; I4: ; I? < !]int=pK>0eO)Duid! 00 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesetuid.cposix_types.htypes.hunistd.h!<'!' !!   ' | DP H | DP HD (T(<`setuidDDlong long intuid_tunsigned intbionic/libc/unistd/setuid.cunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_sizefloatshort int__kernel_uid32_tsetuidGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.setuid.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx{^pZ  npj  ~Dz  p, , p<> $@pz dp  lp |p00o0    B   D $-9bionic/libc/unistd/setuid.csetuid_gp_dispcpuacct_add__setuid !%3:AHOV]dkry      0         $ + /    seteuid.o/ 1331265330 1002 1002 100644 3712 ` ELFP4(!p(% RU$ > $ > $ > : ; I.? : ; ' I@: ; I4: ; I? < xAint!T/>0eQ)D! 0k0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeseteuid.cposix_types.htypes.hunistd.h!uI<'!'$ $$$ (' | DP(D | DP(DD( TseteuidDDlong long intuid_tunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intbionic/libc/unistd/seteuid.cdoubleshort unsigned intsigned char__page_sizeeuidfloatseteuidshort int__kernel_uid32_tGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.seteuid.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx{^pZ   npj  ~Dz  p(  ( p43 (0pg Xp  `p pp00o(    G   D &/;bionic/libc/unistd/seteuid.cseteuid_gp_dispcpuacct_add__setresuid !%3:AHOV]dkry      ,         $    setreuid.o/ 1331265330 1002 1002 100644 3860 ` ELFTP4(!0(% RU$ > $ > $ > : ; I.? : ; ' I@: ; I4: ; I? < Jint*]8>0e!Y)P! !>0t0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesetreuid.cposix_types.htypes.hunistd.h!IK<'!'$ ! ! ! $  (' | PP(H | PP(HP( (T(H` (U(0UsetreuidPPlong long intuid_tunsigned intsetreuidunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoublebionic/libc/unistd/setreuid.cshort unsigned intsigned char__page_sizeeuidfloatshort intruid__kernel_uid32_tGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.setreuid.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 T >xLpx{^pZ \  npj L ~Pz T  p, t,, pX\ `p p  p p00o+;|    H   P (1=bionic/libc/unistd/setreuid.csetreuid_gp_dispcpuacct_add__setreuid !%3:AHOV]dkry       8         $ + / > B I M    setresuid.o/ 1331265330 1002 1002 100644 3952 ` ELFP4(!p(% RU$ > $ > $ > : ; I.? : ; ' I@: ; I4: ; I? < }Aint!T/ >0e[)X! !>x!\0k0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesetresuid.cposix_types.htypes.hunistd.h!IK=<'!'$ !! ! $  (' | XP(H | XP(HX( ,T,P` (U,4U ,VsetresuidXXlong long intuid_tunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftsuidGNU C 4.4.3charlong intbionic/libc/unistd/setresuid.cdoublesetresuidshort unsigned intsigned char__page_sizeeuidfloatshort intruid__kernel_uid32_tGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.setresuid.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx{^pZ  npj  ~Xz   p, H, pto pp  Hp  Pp# `p030P obr   D K    X *3?bionic/libc/unistd/setresuid.csetresuid_gp_dispcpuacct_add__setresuid !%3:AHOV]dkry        @         $ + / > B I M \ `    setpgrp.o/ 1331265330 1002 1002 100644 3172 ` ELFP4(0% RU$ > $ > $ > .? : ; ' I@ 4: ; I? < r;intN)~>)0e0iS bionic/libc/unistdbionic/libc/includesetpgrp.cunistd.h<'!!  !( |   |  setpgrplong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intshort intbionic/libc/unistd/setpgrp.cdoubleshort unsigned intsigned char__page_sizefloatsetpgrpGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.setpgrp.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 D >xLpx]^pZ L  npmj   ~z  p  $ 8  4 pX < pv  D p T p00o p  7    &/bionic/libc/unistd/setpgrp.csetpgrp_gp_dispsetpgid !%3:AHOV]dkry  `        sigblock.o/ 1331265330 1002 1002 100644 3992 ` ELFP4(!t@% RU$ > $ > $ >  : ;  : ; I8 I!I/ : ; I .: ; ' I  : ; I  I .? : ; ' I@: ; I4: ; I : ;  : ; I4: ; I 1X Y 1^m5intH#sig#h} y U) setU  _ )Ph )!n")4#0$)%in&Xout&h ,( bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asmsigblock.csignal.hsignal.h  tH.JTK<'!'< $$' ('@<(@' | PP@D | PP@DP 0TDHRbsigblockPPlong long intthe_masksigemptysetlong unsigned int/u/raghu/ics_feb29long long unsigned intsigblockmaskGNU C 4.4.3sigset_tcharlong intshort intdoubleshort unsigned intsigned charunsigned charfloatbionic/libc/unistd/sigblock.cthe_sigsetunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sigblock.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx ^pbZ  npj  ~Pz  p(  ( (p4G 0@p{ pp  xp p0 0o8    =   P (1bionic/libc/unistd/sigblock.csigblock_gp_dispsigprocmask !%3:AHOV]dkry     %P T          ! % 4 8    siginterrupt.o/ 1331265330 1002 1002 100644 4508 ` ELFP4(!@% RU$ > $ >  $ > ' I : ;  : ; I8 I !I/ : ; I  I : ;  : ; I<  : ;  : ; I8 .? : ; ' I@: ; I: ; I4: ; I 6jint(}X8) sig# h    > fMhi$)} ' da/e0#j#n#y)sig )!X )Jact"*X bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/asm-genericbionic/libc/includesiginterrupt.csignal.hsignal.hsignal.h $MHLoN<'!'<840'!!0!( !@<%0! !( !0<840@'<4$d! !( !0<840@' | P@P | P@P @T@xaa 8U8tbbasiginterruptlong long intunsigned intsa_sigactionunsigned charbionic/libc/unistd/siginterrupt.clong unsigned int/u/raghu/ics_feb29long long unsigned int__signalfn_tsiginterruptGNU C 4.4.3sigset_tcharlong int__sigaction_handlershort intsa_maskdoublesigactionshort unsigned intsigned charsiginfosa_flagsfloat__sighandler_tsa_handlerflagGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.siginterrupt.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np5j  ~z ( p0  0 p<s p# tp  |p p0]0_ oq   HC   # 09bionic/libc/unistd/siginterrupt.csiginterrupt_gp_dispsigaction !%3:AHOV]dkry+7EScn r v    $ T         ! % , 0 7 ; J N U Y ` d    siglist.o/ 1331265330 1002 1002 100644 3592 ` ELFP4(% $ > $ > $ > I!I/  I&I 4: ; I?  e;intN)y| 893 bionic/libc/includesignal.hHangupInterruptQuitIllegal instructionTrapAbortedEMTFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUser signal 1User signal 2Child exitedPower failureWindow size changedUrgent I/O conditionI/O possibleStopped (signal)StoppedContinueStopped (tty input)Stopped (tty output)Virtual timer expiredProfiling timer expiredCPU time limit exceededFile size limit exceeded08@D`ht(8LT`tsys_siglistlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/unistd/siglist.csys_siglistGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.debug_line.rodata.str1.4.rel.data.rel.ro.local.sys_siglist.rel.debug_pubnames.debug_str.comment.gnu.attributes@!@'@,p@5X:XHpXfZpV ` fpt=r2   p" p00o  4 *    bionic/libc/include/signal.hsys_siglist    !/ 6 = D K R Y ` g n u           $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x | signal.o/ 1331265330 1002 1002 100644 6108 ` ELF, P4(# l88% RU$ > $ >  $ > ' I : ;  : ; I8 I !I/ : ; I  I : ;  : ; I<  : ;  : ; I8 .: ; ' I : ; I: ; I4: ; I4: ; I.? : ; ' I@: ; I1RUX Y 1 U41 41.? : ; ' I@9` intu+l|E) sig# h   J = fh0i$)}  Wda'e0#Lj#n#U)~setU~   )#  )sa"*#ghS6) #638`Fa0%rahhd1)#1P3h`a%r+ bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/asm-genericsignal.csignal.hsignal.hsignal.h6 tPJM/JQJ/JSJjJ1%tPJM/JQJ/JS JoJ<'!'4 ''< @ @@ !0@48'$8'<'!'4 ''< @ @@ !0@48'$8' | hP8DhP8D | hP8D,hP8Dh8 HT (UTTR``Rh8 HT (UTTR``R-sysv_signalSbsd_signal$hhT\`T\`4@,0T\`T\`4@,0hhsigemptyset/u/raghu/ics_feb29siginfosa_flagssa_sigaction__sighandler_t__sigaction_handlerbionic/libc/unistd/signal.cfloatunsigned charsa_masklong unsigned intsigset_tshort unsigned intdoubleshort int_signalunsigned intflagssysv_signallong long unsigned intresultsignumhandlerlong long intGNU C 4.4.3char__signalfn_tsigactionbsd_signallong intsigned charsa_handlerGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sysv_signal.rel.text.bsd_signal.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp^pZ ! np/j ! ~$hz ! h !p@  !4@ !pt !p<1 !pm( !p ! p0M 0  o  0" DG   h )2<hbionic/libc/unistd/signal.csysv_signal_gp_dispsigactionbsd_signal  !%3:AHOV]dkry+7ESb      &7 @ DU` d h mw |          , 0  0      $ 3 7 F J Q U d h p t                  $ 0 4 8 < @ D P T X \ h l p t           signame.o/ 1331265330 1002 1002 100644 3304 ` ELFP4(% $ > $ > $ > I!I/  I&I 4: ; I?  eq;intN)y| 993 bionic/libc/includesignal.hHUPINTQUITILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMTERMUSR1USR2CHLDPWRWINCHURGIOSTOPTSTPCONTTTINTTOUVTALRMPROFXCPUXFSZ$(,48@DLT\dltxsys_signamelong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3bionic/libc/unistd/signame.clong intdoubleshort unsigned intsigned charfloatshort intsys_signamecharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.debug_line.rodata.str1.4.rel.data.rel.ro.local.sys_signame.rel.debug_pubnames.debug_str.comment.gnu.attributes@!@'@,p@5X:XHpXfZpV @ fpt=r2  p" p00o   *    bionic/libc/include/signal.hsys_signame    !/ 6 = D K R Y ` g n u           $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x | sigsetmask.o/ 1331265330 1002 1002 100644 4008 ` ELFP4(!t@% RU$ > $ > $ >  : ;  : ; I8 I!I/ : ; I .: ; ' I  : ; I  I .? : ; ' I@: ; I4: ; I : ;  : ; I4: ; I 1X Y 1^wHint[6sig#h}  *U) setU   )Pr )!n")4$0!%)&in'Xout'h ,) bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asmsigsetmask.csignal.hsignal.h  tH-JUK<'!'< $$' ('@<(@' | PP@D | PP@DP 0TDHRbsigsetmaskPPlong long intshort unsigned intthe_masksigemptysetlong unsigned int/u/raghu/ics_feb29long long unsigned intmaskGNU C 4.4.3sigset_tcharlong intshort intdoublebionic/libc/unistd/sigsetmask.csigsetmasksigned charunsigned charfloatthe_sigsetunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sigsetmask.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx ^pbZ  npj  ~Pz  p( (( 8p8G @@p! p  p p00 oD    A   !P ,5bionic/libc/unistd/sigsetmask.csigsetmask_gp_dispsigprocmask !%3:AHOV]dkry     %P T          ! % 4 8    sigsuspend.o/ 1331265330 1002 1002 100644 3556 ` ELFP4(!`% RU$ > $ > $ >  : ;  : ; I8 I!I/ : ; I .? : ; ' I@  : ; I 4: ; I  I&Ie;intN)sig#h}  w)  "0  bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/includesigsuspend.csignal.hsignal.h <'!!( !0 |   |   Tsigsuspendlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/unistd/sigsuspend.c_maskmaskGNU C 4.4.3sigset_tcharlong intdoubleshort unsigned intsigned charsigsuspendfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sigsuspend.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p-Z  np)j t  ~z |  p    p$ p7! pX  px p00| o   ` B   ! ,5bionic/libc/unistd/sigsuspend.csigsuspend_gp_disp__sigsuspend !%3:AHOV]dkry             sigwait.o/ 1331265330 1002 1002 100644 4256 ` ELFP4(!@% RU$ > $ > $ >  : ;  : ; I8 I!I/ : ; I .? : ; ' I@ : ; I 4: ; I  : ;  : ; I4: ; I  I&I=s;intN)sig#h}  x)/ set//! sig/:4 ret1)] 4"e56u7X5) bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/includesigwait.csignal.hsignal.h/(xR<JF<uEOLIK<'!'<840, ! $' $$! !(!0 $A D E <B840,@'<b4!80,@' |  P@T |  P@T `T XUXcc|RRAsigwaitlong long intunsigned chardummy_sigsetlong unsigned int/u/raghu/ics_feb29long long unsigned intkernel_sigsetGNU C 4.4.3sigset_tcharlong intdoublebionic/libc/unistd/sigwait.cshort unsigned intsigned charunsigned intfloatshort intsigwaitGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sigwait.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pXAZ  npj  ~\z 0 pT4 4 p{ p7 xpU  pu p00o   tI    &/Abionic/libc/unistd/sigwait.csigwait_gp_disp__rt_sigtimedwait__errno !%3:AHOV]dkry       X x          ! % 4 8 ? C J N ] a h l    sleep.o/ 1331265330 1002 1002 100644 3844 ` ELFP4(!<(% RU$ > $ > $ > : ; I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I m>intQ,h3ayd#a#0 0 t!p bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxsleep.cposix_types.htypes.htime.h{KLKs M<'!'$!' !(@$(' C$d$$('<B4(' | P(D | P(D( Tsleeplong long intunsigned char__kernel_time_tlong unsigned int/u/raghu/ics_feb29long long unsigned intcharGNU C 4.4.3time_tsleeplong intdoubletv_secshort unsigned intsigned chartimespecbionic/libc/unistd/sleep.cfloattv_nsecshort intunsigned intsecondsGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sleep.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 | >xLpx^p Z  np j l ~z t  pp( ( p3 0p p  p/ p0? 0Lo^n   < =    "+5bionic/libc/unistd/sleep.csleep_gp_dispnanosleep__errno !%3:AHOV]dkry      L         $    statfs.o/ 1331265331 1002 1002 100644 4204 ` ELFP4(!`% RU$ > $ > : ; I$ >  : ;  : ; I8 I !I/  : ;  : ; I8 .? : ; ' I@  : ; I I&I2=intoC40$M8paz>X5Sa8eHvalK#w -Q `' (# Y)# *# +# ,# -# .# /#( q0#0 j1#8 2#@ 3#D  r) j    bionic/libc/unistdbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysstatfs.c_types.hstdint.hposix_types.hvfs.h <'!!0 `$ |   |   T Ustatfsf_type__padf_filesstat/u/raghu/ics_feb29__kernel_fsid_tbionic/libc/unistd/statfs.cf_bsizeuint64_tf_fsidf_bavailfloatstatfsunsigned charf_namelenlong unsigned intf_ffreeshort unsigned intf_bfreef_blocksdouble__uint32_tunsigned intlong long unsigned intf_frsizef_sparelong long intGNU C 4.4.3charshort int__uint64_tuint32_tlong intpathsigned charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.statfs.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p>Z X np5j  ~(z  pD  d  p& $ p Dp  Lp \p0{0ro   T8    $-bionic/libc/unistd/statfs.cstatfs_gp_disp__statfs64 !%3:AHOTafsz*8FTbp~                strsignal.o/ 1331265331 1002 1002 100644 3608 ` ELFP4("|% RU$ > $ > $ >  I.? : ; ' I@ : ; II ! &I 4: ; I? < {Eint%X3S4sig )  o8 za bionic/libc/unistdbionic/libc/includestrsignal.cstring.hsignal.h  Invalid signal number<'!,@(! b$ |  4 |  4 T(4Tstrsignal44long long intunsigned intstrsignalunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intsys_siglistGNU C 4.4.3charbionic/libc/unistd/strsignal.clong intdoubleshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.strsignal.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ np~j  z2d|4 ( p      p p   p.   pN  p0^0HoZj( !  D    %4/8bionic/libc/unistd/strsignal.c$LC0strsignal_gp_dispsys_siglist !%3:AHOV]dkry   n  ( 0          syslog.o/ 1331265331 1002 1002 100644 19692 ` ELF$*P4(63 ((p (% RU$ > $ >   $ > : ; I I  : ;  : ; I8 I !I/ &I.: ;' : ;I.? : ; ' I@ : ;I 4: ;I: ; I.? : ; ' @: ;I.? : ; ' @ .: ;' @ : ; : ;I4: ;I .? : ; ' @ : ; I4: ; I 4: ; I 4: ; I !4: ; I"1X Y #1$ % &!I/'4: ; I? < r~intC(0 3amd  /# 8#!L  `$# j%# # s(}4 tf# Y Z)# [)# @\)# j])# ^.# P_)# `)# Rn M# #  kDn)Vh)ThU2j)i)X)|lL&^FXg.(d.n0 G1%2u3m|tO.eO)^O) O>hK.\eK)o^K)j@pri;)fmt;.ap=98ppqprij)j}fmtj.apj9=cntl)chmpmstmnowngfdo)I o)!o) r 4rqo Xrg!9s)!s)'!)s)q"Tx9#$|Wiovg%Liovg & &  ao<pri`)3`Ffmt`.Yapb9k(=priE)lfmtE.apE9 /D'r 0' 0'B1U bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linux/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includesyslog.cposix_types.htypes.huio.hsocket.hstdarg.hsyslog.hun.hunistd.hLKGIL q<yKK$Hl> <uLwIz;wKFK  <t wNt~0GMBKILIKLGMIQFJJKIiJLNFMEO  t䃃~0[)LUJG(Ds>KGOGKKHLKL<KLu(xJI%h %e %T %s[%ld]Error %d /dev/console <'!h'$("!''! !( n$$$' l$!(  n$$E!@$'$$ !0Q! @$ $q <'!'$ $$@0$! $ $$('<'! $<'!'$0'04 !0@$('<'!'l h d ` \ X T P L H $$!!| @!$$#$ !8 12k*2HK(1 l h d ` \ X T P L H p ' M,24 'y~,'%!8 !  $*@Q(x $+ '$T~ c! 0g !0 $!  !(F( &* T d c#!g0l * :$&$Ϣ& $Ѣ&&(@,'~,'I&!$%$m$UE*&"R&1&! | ! !( !0L(  & i*T T! 01#p$! ! `d!(!0 !8 @w~ ! `l h d ` \ X T P L H p 'ny%.!#!0 $ #$T12 F$d$ q`! ! `$ $d!(!0 !8!@A U$' h1D$$ !0@!@!  >$!W$#P6% $ (! '$$  ! & aX*_%$5?&R&1&]4 ! !0 !(@@ < D F( * RC& d&#B!"D < G@ 0 #!/&$ $($' $Ld e!0 !8`D ! !(f% !8@J(  *HT&  #!!$!#Gg,'&$%$!m$% $ UE*&"R&1&!UE*&+K*`5)&R&1&! '!8@F&!  !( @*T!@&!@!# '!!!#4 @ < D 8 !8@8 ! !(@ !0@H( *(RG& &#B!"@ < D 8 <'!'$4'4 !8@$('<'!!!8$ !0@ |   LP H (PL|P(D @P(D0pPh  <P(D ( |   $4LP H P`(PL|P(D @P(D0pPh  <P(D ( R TL $T$D`( 0T0H`P`(`|( PT`hTt|T @Ut|U LV`|V TW`|W T U V@( 4T 4Up XTXaT$a4aaa8axaaa XUXhch|U|cUccUpc XVX`Vl`8`|`xp` XWXxx 88| |x xpfpf8@fxfR0T0LR|RTT R DTDLRLTRT\pTg0hfg f4|g|fxffpfaa8\aa|aXxaaapa`R` `$R$|`aRaaR|a4`d d|dxddpdbb8$bXxbbpb pRtR((RPRRLRXpRxRR44RRRR8pR<( 0T 0U 0V (T U(R V (Wv setlogmask_rVsetlogmaskcloselog_rcloselogopenlog_rtopenlogsyslogvsyslog_rsyslog_rvsysloglL(|@p<(L(|@p<(setlogmask__kernel_time_tshort intsyslogAddrUnomaskiov_lenopenedsyslogAddrsockaddr_unlogfaclogstattime_tva_listcloselog_rconnectedlog_maskbionic/libc/unistd/syslog.csyslog_datasyslogfloatlong long intidentvsyslogpmaskunsigned charsa_family_tiovecsigned charlong long unsigned inttbuftbuf_leftunsigned intlog_faccloselogsyslog_rsa_data__page_size/u/raghu/ics_feb29disconnectlog_rsaved_errnocharlog_fileshort unsigned intopenlog_rsun_path__page_shiftstdpdataconnectlog_rlong unsigned int__builtin_va_listprleniov_basevsyslog_r__prognamesun_familyfmt_cpysa_familylog_stat__gnuc_va_listfmt_lefterrordouble__kernel_size_tGNU C 4.4.3sdatalong intopenloglog_tagsockaddrsetlogmask_rGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.setlogmask_r.rel.text.setlogmask.rel.text.closelog_r.rel.text.closelog.rodata.str1.4.rel.text.connectlog_r.rel.text.openlog_r.rel.text.openlog.rel.text.syslog.rel.text.vsyslog_r.rel.text.syslog_r.rel.text.vsyslog.data.sdata.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X`5 8X4>Lp^pvZ $94 npJ Yj =X4 z 4>(4L \>4  t>(42<( >P4| > 4 ?(4@ 4?4+p' L?4?L<; ,A4R(N DA(4!`ppl lA4$} BX4&p tB` 4(p# K4*pQ$p K`4,p$` @< !%3:AHOV]dkry$:EQ_m{  *8FQXc g s}    #'+4?DOT_dov}  $)3BP_mz %):>X\*8>JO\i    BSi1H00 . 00 200 1 008 4p 5l t 6 7 8 200H P00 9 00 <00X \d >h l ?  @ A !!8 B\ A "X "`" C ##4 D 9  E 1 ; $ $8 ?d 2 F E ? G %% H4 I, &<&h 2 A I '$'X 9 A (( J ""P K L ))  A00 =00 =  $( 48 PT `d  ( 8 T d    & * 2 6 F J Q U dhpt  $+/>BIM\`os !(,37>BIMTX_cjn}  #*.=AHLUYaenrz~ ")-48?CJNUY`dsw~  $+/6:IMTX_cjnuy  '+26=AHLSW^bqu|#37FJY]lp   ( 08@HPX`        $(,048<@DHLPTsystem.o/ 1331265331 1002 1002 100644 6216 ` ELFH P4("h% RU$ > $ > $ >  I' I: ; I  : ;  : ; I8 I !I/ .: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I4: ; I4: ; I4: ; I 1RUX Y 11RUX Y  U41&I4: ; I? < eEHintab7p\@)9")PH  sig# h }1c U)setU C)HsetCC)EHh a) H) !pid+?,0,-V-Dm.)/+T46D71&0<& ; })3H00A bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/syssystem.csignal.hposix_types.htypes.hsignal.hunistd.hstdlib.h)((JaJwJmJEhJ(Ja$uu=Kqt=JhJssh-c/system/bin/sh<'!'d`\XTd'$%P!@@$,' !0$ <' $$ $$$ !@! '!0 !@!0$,' !@!(` $!(@ $0d`\XTh'$,' !0$d`\XTh'd$`\XTh'$ |  PhT |  PhT lTTaRaR|aRaatcccxbbbpiNsystem48\hDHTXDHTX__page_sizesigemptysetargp/u/raghu/ics_feb29quitsave__kernel_pid_tcommandpid_tomaskfloatunsigned charlong unsigned intsigset_tshort unsigned intsigaddsetdoubleunsigned intintsavelong long unsigned intlocal_setsignumlong long intGNU C 4.4.3masksystem__page_shiftshort intenvironsig_tlong intcharbionic/libc/unistd/system.csigned charpstatGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.system.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 0 >xLpxe^piZ 8 npFEj  z2  p4 x 4  p 0 p  p   p3 X p p0 s 0 o  % ! v    " ' ,3<HNYahnbionic/libc/unistd/system.c$LC1$LC0$LC2system_gp_dispsigprocmaskvforkbsd_signalenvironexecve_exitwaitpid !%3:AHOV]dkry2=P[ _ c lv       <O\ 8 0 <, @x         !( D X         ! % , 0 ? C J N U Y ` d k o v z                           $ 0 4 8 < H L tcgetpgrp.o/ 1331265331 1002 1002 100644 3840 ` ELFP4(!d(% RU$ > $ > $ > : ; I.? : ; ' I@: ; I4: ; I 4: ; I? < Aint!"T/")HLfd) , 3 0 0 k.0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includetcgetpgrp.cposix_types.htypes.hunistd.hioctl.hvKK<'!'$@xLpx^pZ p  npj ` ~Lz h p0( X( pG @p  p  p p010H oZj   , 9    L *3bionic/libc/unistd/tcgetpgrp.ctcgetpgrp_gp_dispioctl !%3:AHOV]dkry               $ 3 7    tcsetpgrp.o/ 1331265331 1002 1002 100644 3840 ` ELFtP4(!` % RU$ > $ > $ > : ; I.? : ; ' I@: ; I: ; I 4: ; I? < /`int!sN")H")<fd) ,3 0 0 .0 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includetcsetpgrp.cposix_types.htypes.hunistd.hioctl.huIK <'!'$<$' vt4 ' | <P D | <P D< 0T $U$<$tcsetpgrp<<long long intpid_tunsigned intunsigned charbionic/libc/unistd/tcsetpgrp.clong unsigned int/u/raghu/ics_feb29long long unsigned int__invalid_size_argument_for_IOC__page_shiftGNU C 4.4.3charlong intshort int__kernel_pid_tdoubleshort unsigned intsigned char__page_sizefloattcsetpgrp_pidGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.tcsetpgrp.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 X >xLpx^pZ `  npj P ~<z X p( p<( pdR Pp  p  p p0107 oIY    9    < *3bionic/libc/unistd/tcsetpgrp.ctcsetpgrp_gp_dispioctl !%3:AHOV]dkry               $ 3 7 > B    time.o/ 1331265331 1002 1002 100644 6220 ` ELF| P4()&W(((% RU$ > $ > $ > : ; I : ;  : ; I8 .: ; ' I  4: ; I .? : ; ' I@ 1X Y  41 .: ; ' @: ; I4: ; I 4: ; I I4: ; I 6O intgl*Au[W3a4a6aO6`cdF:#a#:#-#=D)# )##1` tm3 p D,H , Up<x  D,> , Up 5(X@"t""`tt$pret%v9 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxbionic/libc/includetime.cposix_types.htypes.htime.htime.hot<T<wt <0"FN?KL<'!'$' $D(Lp^p:Z ' np#j T' ~,z l8' x 8'$ '(X 'p\ 0'\ ,'p@ D'p%  '"p 0  '5p< 1 0'!Cp0\N0 Wo  g ( f   'x!#2$%7 =FTXYbionic/libc/unistd/time.cclock_startclock_crt0$LC0clock_gp_dispclock_gettimetimegettimeofday  @  !%3:AHOV]dkry (6Ebm q u          )5   0 <T ` 0 <T t  ! ,0 DH 0 H     $ , 0 @DLP`dkovz      umount.o/ 1331265331 1002 1002 100644 3384 ` ELF P4(! % RU$ > $ > $ > .? : ; ' I@ : ; I I&I 4: ; I? < yBint"U0 )dir  0 l0hR bionic/libc/unistdbionic/libc/includeumount.cunistd.h  <'! !( |   |   Tumountlong long intumountunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_sizefloatshort intbionic/libc/unistd/umount.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.umount.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx~^pZ   nplj  ~<z  pT  t  p p  p   p ( p00oH    5    $-bionic/libc/unistd/umount.cumount_gp_dispumount2 !%3:AHOV]dkry   _          unlockpt.o/ 1331265331 1002 1002 100644 3632 ` ELFP4(!`(% RU$ > $ > $ > .? : ; ' I@: ; I4: ; I 4: ; I? < .^int!qL )<fd) !)p00.0 bionic/libc/unistdbionic/libc/includebionic/libc/kernel/arch-mips/asmunlockpt.cunistd.hioctl.hwL <'!'$<' 1T4$(' | <P(D | <P(D<( 0Tunlockpt<<long long intshort unsigned intunsigned intbionic/libc/unistd/unlockpt.clong unsigned int/u/raghu/ics_feb29long long unsigned int__invalid_size_argument_for_IOC__page_shiftGNU C 4.4.3char__page_sizelong intunlockdoubleunlockptsigned charunsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.unlockpt.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx}^pZ  npj  ~|<z  p( ( p3 0p; pZ  pz p00o    7   < (1bionic/libc/unistd/unlockpt.cunlockpt_gp_dispioctl !%3:AHOV]dkry              $    usleep.o/ 1331265331 1002 1002 100644 3908 ` ELFP4(!0% RU$ > $ > $ > : ; I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I )gintzUE3ad#a#) h ts!h bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxusleep.cposix_types.htypes.htime.hzJPzJPzJP zJ=L<'!',($C<5 <`@Bj5D H q#0(9#!F '$!  !(@ O$,($0' | P0L | P0L0 \Tusleeplong long intunsigned intunsigned charbionic/libc/unistd/usleep.c__kernel_time_tlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3usleeptime_tlong intdoubletv_secshort unsigned intsigned chartimespecfloattv_nsecshort intuseccharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.usleep.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p Z  np j  ~z   p0 0 p3 0p3 pP  $pp 4p0 0o   | ?    $-7bionic/libc/unistd/usleep.cusleep_gp_dispnanosleep__errno !%3:AHOV]dkry     h          $    wait.o/ 1331265331 1002 1002 100644 8148 ` ELF<P4('$(% RU$ > $ >  $ > : ; I : ;  : ; I8  : ;  : ; I  : ;  I !I : ; I8  : ;  : ; I!I/ .? : ; ' I@: ; I: ; I I.? : ; ' I@ .? : ; ' I@ Aintu#Fg*,|")3a4aM6ak7)2>0(06<HcdivA#Z#4H.##a#a#~a#a#a# a#$ a#(C!a#,"a#0#a#4$a#8%a#<^&a#@'a#D Q l) }. %U'#(# * , #c-)#P.#;/Q#C1)#   3U4#6#;7Q# 9aU;#<#=)#># @# BUC#E#F)#G# JK}# QRa#_fdT)#t#? P$? )\ 2_rt8 A &Ha P U )O)#N)# )#"# V# ) YWOb 9) ;)0 &1 id13-1 F1)Y> 1ppid,l,p,)) 2('p')4'A 0$"p9 bionic/libc/unistdbionic/libc/kernel/arch-mips/asmbionic/libc/arch-mips/include/machinebionic/libc/include/sysbionic/libc/kernel/common/linuxbionic/libc/kernel/common/asm-genericwait.cposix_types.hkernel.htypes.htime.hresource.hsiginfo.hsiginfo.hwait.h1v , 'KIK"<'!'$ $('<'! !8<'!!!8!(!0@ $<'!!(!0$ !8 | 0P(D  ( $ | 0P(D , <( L$0( $T $U $V $W T U V T U(R V (W T8waitid&waitpidvwait3wait40($0($ru_ixrss_tid_utime__kernel_suseconds_tlong long unsigned intGNU C 4.4.3__kernel_clock_tru_nvcswlong long intsigned charru_msgsnd_sifields_sigchldlong int__kernel_time_tru_minfltwaitiddoublewait3si_errno__pad0clock_toptionssigval_tsigvalsuseconds_t_statusunsigned intwhichlong unsigned intwaitpidshort unsigned intsiginfo_t_overrunsival_inttimevalru_idrss__kernel_pid_tru_nsignals_band_sigpolltv_secru_oublockid_tru_stimetime_tru_isrssfloatbionic/libc/unistd/wait.cru_majflt_sigfaultunsigned charshort intinfo__kernel_uid32_t_sys_private_pad_pidtv_usecidtype_t__kernel_timer_tcharpid_t_addrwait_stime_killru_utimesiginforu_maxrssru_nswap_uidstatussi_signo/u/raghu/ics_feb29_timertimer_tru_msgrcvru_nivcsw__kernel_id_tsival_ptr_irix_sigchldrusage_sigvalru_inblocksi_codeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.waitid.rel.text.waitpid.rel.text.wait3.rel.text.wait.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5  %>LpB^pZ % np j  % ~ 0z %   % ( % $ %p( X @% X T %p  t%p < d%p 8 l(%pS ( @%#p0{ V.07oGT& DO   !"#0 "+4<D(J$bionic/libc/unistd/wait.cwaitid_gp_disp__waitidwaitpid__wait4wait3wait @` !%3:AHOV]dkry%3BN\jx /;FRes)7ESjx)4P\jx   (3 7 MR\akx    F X h {       , 0 < @ L P  0 @ P      $ 3 7 F J Y ] l p                    (         asprintf.o/ 1331265331 1002 1002 100644 5504 ` ELF P4(!% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@: ; I4: ; I4: ; I 4: ; I : ; I0pLlintRZF(}a aCN ,W X# YE#0 Tw _px# _ryE# _wzE# ){7# [|7# _bf}# ~E# # %"# ;B#$ b#( #, M#0 _up#8 _urE#< #@ |#C _lb#D E#L 3#P E"  EB E( b EH E  Eh00AfWEFstrF!fmtJretE]apf err4J bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeasprintf.cstdarg.hposix_types.htypes.hstdio.hHKKxJKyJR=LIKHHLKIKRvtPK=<'!x'|$B$p*(! $,@p$''0$ $D!@, E$@! |', ! @ $ $F | PL | PL DTD`` 0UaRaaMasprintfoff_t__builtin_va_list_ubuffpos_t_close__sbuf_offset_readFILEfloatunsigned charlong unsigned intshort unsigned int_blksizeva_list__sFILEdouble__gnuc_va_listunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write_cookieshort int_flagsbionic/libc/stdio/asprintf.c_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeasprintfGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.asprintf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pMZ  npj ` ~lz h8 pl0 0 p p] Xp|  `p pp00F oX h   hW    '07BJObionic/libc/stdio/asprintf.casprintf_gp_dispmalloc__vfprintfreallocfree__errno !%,3:AOV]dkry$2N\jx      0A W  d           ! % , 0 7 ; J N ] a h l s w ~     clrerr.o/ 1331265331 1002 1002 100644 4812 ` ELFp P4(!(% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' @: ; I4: ;I? <   aV-vintCdPR aC(N>W X# YE#0Tw _px# _ryE# _wzE# 7{7# L|7# _bf}# s~E# %}# /# E1#$ Q#( |#, >#0 _up#8 _urE#< #@ m#C _lb#D E#L 6#P E } E1 } E Q } E7 Eq } q Ew W00Kfp' E bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeclrerr.cposix_types.htypes.hstdio.h'9KIIL<'!'$ " @! 0 $ ('  $0 ! $  (' | P(L | P(L( 0T0H`HPTP`clearerroff_t_size/u/raghu/ics_feb29clearerrfpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEdoubleunsigned intbionic/libc/stdio/clrerr.clong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.clearerr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pYZ h npCj  ~$z ( p0 ,0 <pT D`ph p  p p0|03oEU  8Q    %.;Ebionic/libc/stdio/clrerr.cclearerr_gp_disp__isthreadedflockfilefunlockfile !%,3:AOV]dkry!=KYgu      P t         $ + / 6 : A E    fclose.o/ 1331265331 1002 1002 100644 5452 ` ELF, P4(!(% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I4: ;I? < ;% nP-intf|h1u aC@NVW X# YE#0Tw _px# _ryE# _wzE# Z{7# o|7# _bf}# ~E# H}# G# ]1#$ Q#( 6|#, a#0 _up#8 _urE#< #@ #C _lb#D E#L N#P E } E1 } E Q } E7 Eq } q Ew W00c& 'E#= # _ub$# %#E\*fp(* r*EIE bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefclose.cposix_types.htypes.hstdio.hwcio.hfileext.h($KKKKIILw:9=<'!'$  E@!E<B04@!   D($ 1"0D@ & 0@D DJ @ ! $!  ('  ! !@   $ $C$ | \P(P | \P(P\( 0T0`\`Paa$,aD\a?fclose\\off_t_size/u/raghu/ics_feb29wchar_io_datashort unsigned intfpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intdummy__isthreadedfclose_blksize_ubuf_wcio__sFILEdoubleunsigned intlong long unsigned int_seekbionic/libc/stdio/fclose.clong long int_baseGNU C 4.4.3char_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fclose.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pj?Z  np j $ ~\z ,P p(0 |X0 p} p $p"  ,pB <p0R0 o  T  $e   \ #,9CLQ]bionic/libc/stdio/fclose.cfclose_gp_disp__isthreadedflockfile__sflushfreefunlockfile__errno !%,3:AOV]dkry!=KYgu    % 1 0 < H     @         $ + / 6 : I M T X _ c j n    fdopen.o/ 1331265331 1002 1002 100644 6028 ` ELF P4(!?0% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@: ; I: ; I4: ; I4: ; I4: ; I? < P+intx= Z{n)i a CFN\W X# Y)#>Tw _px# _ry)# _wz)# G{E# c|E# _bf}# ~)# 5}# M# c1#$ Q#( .|#, N#0 _up#8 _ur)#< #@ #C _lb#D )#L T#P ) } )1 } ) Q } )7 )q } q )w W>>it43 3fd*) *qIfp,3\-)S-)-)tmp-)Q00 bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefdopen.cposix_types.htypes.hstdio.hunistd.h*$FNuJgtKDzJKKKELKKKK<'!',($ !! '@!@!,($ 0'! $ !0@!@B0$ C0 $F! @1 PR2@ 6 IQ$M,L(K JB |  P0P |  P0P 0 0T0Ta` a 0UHLRR R<X``tRt`H`hhUhUh XDHRHPbxbRb bRRTfdopen  __page_sizeoff_t_size/u/raghu/ics_feb29bionic/libc/stdio/fdopen.cfpos_t_close_offset__sbuf_readFILEfloatfdopenlong unsigned intshort unsigned int_blksize_ubuf__sFILEfdflagsdoubleunsigned charunsigned intflagslong long unsigned int_seekmodelong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extoflagslong int_file__kernel_off_tsigned char_nbuf_lbfsize__page_shiftGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fdopen.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 t>xLpx^pTZ | npj < ~ z DX p0 ,0 p\o p dp  lp  |p0 0 o    k     #,5;CIQZbbionic/libc/stdio/fdopen.cfdopen_gp_disp__sflagsfcntl__errno__sfp__sread__swrite__sseek__sclose !%3:AHOV]dkry!=KYgu         . :G $ `                $ + / 6 : I M \ ` g k r v                          ! ( , 3 7 > B Q U \ `    feof.o/ 1331265331 1002 1002 100644 4904 ` ELF P4(!0% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I4: ;I? < UGgint7UAF aCN/W X# gYE#0Tw _px# _ryE# _wzE# {7# @|7# _bf}# m~E# }# # 61#$ Q#( |#, #0 _up#8 _urE#< #@ a#C _lb#D E#L '#P E } E1 } E Q } E7 Eq } q Ew W00<Efp+ ret-ETzE bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefeof.cposix_types.htypes.hstdio.h+8KIILHL<'!',($" @! B10,($0'  #B!`0!  ,($0' | P0L | P0L0 0T0H`HPTP`<@Rl|Rfeofoff_t/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEdoublefeofunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extbionic/libc/stdio/feof.clong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.feof.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pjZ p npgj 8 ~Dz @( p0 h0 xp@r p p  p p0v0so  tK    (5?bionic/libc/stdio/feof.cfeof_gp_disp__isthreadedflockfilefunlockfile !%,3:AOV]dkry!=KYgu       P t         $ + / 6 : A E T X _ c    ferror.o/ 1331265331 1002 1002 100644 4060 ` ELFP4(% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@ : ; I  Roint4}i C aC:NWW X# YE#0Tw _px# _ryE# _wzE# ({7# =|7# _bf}# d~E# }# A# ^1#$ Q#( |#, /#0 _up#8 _urE#< #@ ^#C _lb#D E#L O#P E } E1 } E Q } E7 Eq } q Ew W00dHEfp*T bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeferror.cposix_types.htypes.hstdio.h* B0 |   |  ferroroff_t_size/u/raghu/ics_feb29bionic/libc/stdio/ferror.cfpos_t_closeferror_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.ferror.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 <>xLpx^pJZ DP np'j  zp    p8 pU  pu p0m0o P #    bionic/libc/stdio/ferror.cferror !%,3:AOV]dkry!=KYgu         fflush.o/ 1331265331 1002 1002 100644 7220 ` ELFP4($!|(0(% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I4: ; I 4: ;I? < $ x]D}intZkW0i aC(NEW X# YE#0Tw _px# _ryE# _wzE# N{7# c|7# _bf}# ~E# <}# /# L1#$ Q#( 5|#, U#0 _up#8 _urE#< #@ #C _lb#D E#L 6#P E } E1 } E Q } E7 Eq } q Ew W00R9Efp9 p;jnE9vfp(Yr*EEG bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefflush.cposix_types.htypes.hstdio.h9FOEJLLOEKIOjtJv<J>8($=z@z w 'C0 $`! B0#@B!( ,YD !0#@!" E$@4$ D ('$! ('!B<'!',($@! ! ` ! ,($0' <'!'$ &!"@ 0` ! !@&$ ! $!@ (' $ $E& $  (' | H(TP0LP(P | H(T4P0LTP(P($T$0b0HTHbbT(aaa8```4RH`Rd|RR0 0T0dapa( <T<``T`T``bb:__sflush__sflush_locked=fflush,off_t_size/u/raghu/ics_feb29__sflushfpos_t_close_offsetfflush__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEdoubleunsigned int__sflush_lockedlong long unsigned intbionic/libc/stdio/fflush.c_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__sflush.rel.text.__sflush_locked.rel.text.fflush.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X`5 ">Lp^pZ " np>Kj " zH 0" ,H"pp t0" p "p   "pX > "p 0  " p   0"p0 &0y /o  ?|# |w     %5>KWahpbionic/libc/stdio/fflush.c__sflush__sflush_locked_gp_disp__isthreadedfunlockfileflockfilefflush__errno_fwalk @ !%,3:AOV]dkry!=KYgu    -?J N Rdqw    0 H p , 8 H L l     4 8 T X  8 X      $ + / 6 : A E L P W [ j n u y                         & * 9 = E I Y ] d h o s z ~                    fgetc.o/ 1331265331 1002 1002 100644 4648 ` ELFP4(!% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@ : ; I4: ;I? <   ]M)mint?[GN aCN5W X# YE#0Tw _px# _ryE# _wzE# 3{7# H|7# _bf}# o~E# !}# &# <1#$ Q#( |#, :#0 _up#8 _urE#< #@ i#C _lb#D E#L -#P E } E1 } E Q } E7 Eq } q Ew W00BEXfp%E bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefgetc.cposix_types.htypes.hstdio.h% <'! @!$ %d   |  X |  X T,S,4T4LSLXTfgetcXXoff_t_size/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubufbionic/libc/stdio/fgetc.c__sFILEdoubleunsigned intlong long unsigned int_seekfgetclong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fgetc.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p[Z ` npHj h ~ Xz p( px    p? Pp p  p3 p0Cx0o  D   X !*7<bionic/libc/stdio/fgetc.cfgetc_gp_disp__isthreadedgetc__srget !%,3:AOV]dkry!=KYgu     @ L          ! % , 0    fgetln.o/ 1331265331 1002 1002 100644 7648 ` ELFP4(!@% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .: ; ' I : ; I: ; I4: ; I.? : ;' I@: ; I: ; I4: ; I : ;  U4: ; I1RUX Y 1411RUX Y 4: ;I? < )}SIxint_fM5Ln a C%N;W #X# YE#0Tw  _px# _ryE# _wzE# S{7# h|7# _bf}# ~E# A}# ,# B<#$ \#( :#, Z#0 _up#8 _urE#< #@ #C _lb#D E#L 3#P E }  E< } E" \ } EB E| } | E b00H/Efp//p1}ZfpG!aGUpIretJlenKoffL;P pz(H$hwEH bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefgetln.cstddef.hposix_types.htypes.hstdio.h4zJPLKLHIHLKL8(x UJJJwHKJJPJHLKINOHL$IK?IK4J<'!'<840,($ !b#@!'@!  $ !0@,@C$#Hq e# 5!  Q<840,($ @' @ ! V@!  $ !0@@!H PV&+Pv<@D!( #0U !  !  $@!  !0B@!( U$#H !@!2+`1D!0  ! V#oD!  <840,($ @'D !(@! @HDb@<! !D !(@@DH!@!V | (P@` | (P@` HTH``$` HUHd d$dxSeSePe|aRhpRd|b|YbYb$be$ee$peeaaaPafgetln$p$Ppp$($P,<$($P,<__slbexpandoff_t/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned charlenplong unsigned intshort unsigned intsize_t__isthreaded_blksize_ubuf__sFILEdoublenewsizeunsigned intlong long unsigned int_seekbionic/libc/stdio/fgetln.cdifferrorlong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizefgetlnGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fgetln.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj  ~z  p <  < p  p  p  p  p0 0HoZj  o    #,9CJT[cbionic/libc/stdio/fgetln.cfgetln_gp_disp__isthreaded__srefillmemchrflockfilememcpyreallocfunlockfile !%,3:AOV]dkry,HVdr    % 2 A P _ dj ot~   U 4 P X    < T l    $ `        ! % , 0 7 ; B F U Y ` d k o v z                          ! ( , ; ? F J Q U \ ` g k z ~                ( , 0 4 8 < H L P T X \ h l p t x |         fgetpos.o/ 1331265331 1002 1002 100644 4572 ` ELFP4(!,(% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I TMmint1[G:E aCN5W X# YE#0Tw _px# _ryE# _wzE# %{7# ?|7# _bf}# f~E# }# &# <1#$ Q#( |#, ,#0 _up#8 _urE#< #@ `#C _lb#D E#L -#P E } E1 } E Q } E7 Eq } q Ew W00BE@fp( pos(3 bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefgetpos.cposix_types.htypes.hstdio.h(uK <'!'$ $C$('b, | @P(D | @P(D@( $T U4@Ufgetpos@@off_t_size/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEbionic/libc/stdio/fgetpos.cdoublefgetposunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3_write_cookieshort int_flags_extlong intchar_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fgetpos.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pJZ h np?j , ~@z 4 pD( Ll( \pQ dPp p  p# p03o0o  5   @ %.bionic/libc/stdio/fgetpos.cfgetpos_gp_dispftello !%,3:AOV]dkry!=KYgu               $ 3 7 > B    fgets.o/ 1331265331 1002 1002 100644 6616 ` ELF P4(!H% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I4: ; I4: ;I? < C^A*aint@O;tLO aCN)W X# pYE#0Tw  _px# _ryE# _wzE# 4{7# I|7# _bf}# v~E# "}# # 0<#$ \#( #, ;#0 _up#8 _urE#< #@ j#C _lb#D E#L !#P E }  E< } E" \ } EB E| } | E b0062buf-!n-Ekfp-2len/s0up1t1{EG bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefgets.cstddef.hposix_types.htypes.hstdio.h-8OKwJKI  tLIMHu L[$tKo0KILK P00tNJ2J[,<'!'D@<840,($!^!T@$%@!q*Q! t P!!  $ !0#80!#P!(!  @!0g c @!q  ! `B@qD!@<840,($H'F$##2fq!0@ !D ! `D!@<840,($H' ! D!!@<840,($H'`D ! `! | ,PHd  | ,PHd  DTDf0T0fff XUX b08bdbUUb DVDc0V0ccVchl`|`(`08`8dbd````ee0Hedeee4HVGfgets/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned intsize_t__isthreaded_blksize_ubuf__sFILEdoublebionic/libc/stdio/fgets.cunsigned intlong long unsigned int_seekoff_tlong long int_baseGNU C 4.4.3charfgets_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fgets.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 P>xLpx^pwGZ X npj  ~z P p@ H@ Xp  `Pp  p  p*  p0: 0 o    e    !*7AHOYbionic/libc/stdio/fgets.cfgets_gp_disp__isthreadedflockfilememchrmemcpy__srefillfunlockfile !%,3:AOV]dkry,HVdr        - 9T D P |    d         ! % , 0 7 ; B F M Q X \ k o v z                            $ + / 6 : A E L P W [ b f u y                fileno.o/ 1331265331 1002 1002 100644 4904 ` ELF P4(!0% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@: ; I4: ; I4: ;I? < /Ybint;p\ J aCNJW X# kYE#0Tw _px# _ryE# _wzE# ({7# D|7# _bf}# q~E# }# # Q1#$ Q#( |#, 6#0 _up#8 _urE#< #@ e#C _lb#D E#L '#P E } E1 } E Q } E7 Eq } q Ew W00W/5Efp+ ret-ETE bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefileno.cposix_types.htypes.hstdio.h+M8HLHL<'!',($"@!,($0' #`!  ,($0' | P0L | P0L0 0T0@`@HTH`48R\lRfilenooff_t/u/raghu/ics_feb29fpos_t_close_offsetbionic/libc/stdio/fileno.c__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flagsfileno_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fileno.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pjZ p nphj 8 ~Hz @( p0 h0 xp4r p p  p p0z0mo  pO    #,9Cbionic/libc/stdio/fileno.cfileno_gp_disp__isthreadedflockfilefunlockfile !%,3:AOV]dkry!=KYgu       H d         $ + / 6 : A E T X _ c    findfp.o/ 1331265331 1002 1002 100644 10536 ` ELF8P4(30((% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/  : ; 5I.: ; ' I : ; I4: ; I4: ; I.? : ; ' @4: ; I  : ; .? : ; ' @ .? : ; ' I@4: ; I : ; 1X Y 1  41!41"41 #4: ; I? < $4: ; I?  uintU2F>  aCNW X# Y)#>Tw _px# _ry)# _wz)# /{E# o|E# _bf}# ~)# ~}# # 1#$ cQ#( w|#, #0 _up#8 _ur)#< #@ V#C _lb#D )#L #P ) } )1 } ) Q } )7 )q } q )w W>>& ')#~ # _ub$# %#A '( ((# j))# *.#)K P*K#)+49P) + p ,P# \ -[#F(nF)gH(pI. JiK6L"fi)outɈf. fph.@ni)tgj(3~|x !! ";7n89&:(G;fR=B# 0# 0$i}$,)$bC bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includebionic/libc/privatefindfp.cposix_types.htypes.hstdio.hwcio.hfileext.hglue.hpthread.hthread_private.hunistd.hIz JIKL $>IKJIK vJMOL~EKLKNGNLcJW}LLL tJ<IH!Hq <'!'$  &"@$0c$D$b@@ B$DTc$ $%&$  ('<'! <'!'$ bf@ $&$$A!DT& B$$$&  0D@0$H $! (' $& $2@!@D$$$ H$ $E@Dk%PJ%!` !`!PON MB$pon mJc$_0 0T$ )% $&P,2 !T  | P(L P(P | P(L 4DP(P((P`T```PTRTXVXRRPUU PTPST,YU__sinit"_cleanup6__sfp__sF__sdidinit__sglue,_wcio__page_size__sbuf_ext_offsetlastglue_flagsdatausualglueshort intvalue_nbuf_private_key__sFusualext_write__sfileext_cleanupfloatmoregluelong long int__sfplong intdummy_blksize__sdidinituglueoff_t_closeunsigned char/u/raghu/ics_feb29pext_readbionic/libc/stdio/findfp.csigned charlong long unsigned intunsigned int__sglueniobs_private_lock_cookie_base_lbfsizechariobs_thread_tagname___sinit_mutexfpos_t__sFext__page_shift__sinitshort unsigned intlong unsigned intdouble__kernel_off_t__thread_private_tag_tfoundpthread_key_t_thread_tagname___sfp_mutex_seekempty_fileGNU C 4.4.3FILEpthread_mutex_t_ubuf_sizenext__sFILEwchar_io_dataGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__sinit.rel.text._cleanup.rel.text.__sfp.rel.data.rel.__sF.rel.data.rel.__sglue.data._thread_tagname___sinit_mutex.3189.data._thread_tagname___sfp_mutex.rel.data.rel.local.lastglue.bss.empty.3137.bss.usual.bss.usualext.bss.__sFext.rel.data.rel.local.uglue.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X`5 "1>Lp^pZ ("81 npKj `%1 ~ z x%p1   % 1  &1  &1  H'1  ' # X'1@ TP [ i $z v `'1p ` h'01!0` '1#p ' 1%pY (1'p0 ( 1)p  (01+p0;0 o 02)  ?   ?HNjTu~$ !#%')+-./   &.6bionic/libc/stdio/findfp.c_thread_tagname___sinit_mutex.3189usualextusual_thread_tagname___sfp_mutexempty.3137lastglue__sFextuglue__sinit_gp_disppthread_mutex_lock__sdidinit__atexit_register_cleanup_cleanuppthread_mutex_unlock_fwalk__sflush__sfp__sgluemalloc__sF__sclose__sread__sseek__swrite) .@2 $$$!#%3$:$A$H$O$V$]$d$k$r$y$$$$$$$$$$!$=$K$Y$g$u$$$$$$$$$$$$$$ $$=$Q$\$g$s$$$$$$$   $  $$+ / 8$CGK ] j w |$  $$ $!$-2$>S$_d$q$$5$,$3 < M**$ +( ,0@ HD Ll -p . / ** 0 1**$ ,0 )8 +@L 3| / / 4  <$ @ +4  5 6$7(8,90p5t6x7|89567895 48 DH 8 H    $,0@DKOVZaetx      flags.o/ 1331265331 1002 1002 100644 4256 ` ELFPP4(! % RU$ > $ > $ >  I&I.? : ; ' I@: ; I 4: ; I 4: ; I? < @intS.j.)). .> ret0)\ m0) o0)) 0 s0P bionic/libc/stdiobionic/libc/includeflags.cunistd.h.w$ uJ qII JLzLGMmII}I<'!'r$(C!@w$!Fa$ G $D '!$$$+$ g$b $i%X 'G$%X$$$$!0$ | P D | P D DT\T DU\UTTRhRRRRdVVV`XXX__sflagslong long intunsigned intunsigned charmodelong unsigned int/u/raghu/ics_feb29long long unsigned int__sflags__page_shiftGNU C 4.4.3charlong intoptrbionic/libc/stdio/flags.cdoubleshort unsigned intsigned char__page_sizefloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__sflags.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 0>xLpx^pZ 8 npj 0 ~z 8 p( P( `p hp xp  p p00o%5x    5    $-bionic/libc/stdio/flags.c__sflags_gp_disp__errno !%3:AHOV]dkry         ] 8         $ + / > B I M \ ` g k r v }                   flockfile.o/ 1331265331 1002 1002 100644 13392 ` ELFP4(+( 8(((% RU$ > $ > : ; I $ >  I : ;  : ; I8 : ; I8 ' I I &II!I/  : ; 5I : ; ( .: ; ' I : ; I4: ; I .: ; ' .: ; ' @.: ; ' I .? : ;' @: ; I4: ; I1RUX Y  U 4: ; I!1X Y "1# $41%4: ; I &1X Y '1RUX Y (.? : ; ' @)1RUX Y *.? : ;' I@Pmbint{4WSe%5Ll lC/N?W X# YE#0Tw _px# _ryE# _wzE# ?{7# |7# _bf}# ~E# # r'# G#$ 9g#( F#, #0 _up#8 _urE#< #@ #C _lb#D E#L #P E'  EG E- g EM E  E m00) l*#EM+1##Ml 6Y 7Y# ]8_# 9#" :"B *C# D#eFEpyctcfc_efkA] t]{KUc=L 1fpt_@tvi4,v y *z! "!hy""#h$$#t$#L%}`& 8D"?fp_t84 0H *V' `"&\""#\$$#h$( tfp_t4 x  *ɥ!\ȓ""#\$$#h$) "*>E-xfp_MretEvt4  *' \9"&t""#t$$#$%6G%HP bionic/libc/stdiobionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysflockfile.c_types.hstdint.hposix_types.htypes.hstdio.hpthread.h==>b,JbJIJqnHs6i仉L=>S$JJIJsHJJIJs~KJJJIJJ<'!' $@! @ !($!($  ' '<'!'40,($ !$ $ `|22!rPR&"! ! ` &40,($ 8'  $@!@'! Q @!  $!( &P ! `4<'!'$ !$ $ $1 |2!#D !  $! $  ('$ ('<'!'$ !$ $ $$(|2!q "c$'&! 1  ! $  ('' g! $  ('$ ('<'!'$ !$ $ $$$$ ('|2!Q 1 &  $&@$$ $ | P H$LP8XP(L P(LP(L | P H$0LP8XXP(Lx P(LP(L L8 8T8aLa`cLcbLbt``R8`8DRDL`( ,T,``TaahTT ( ,T,```TTT TSShaa( ,T,l`t``dRRTTT\haaOAflockfile1funlockfile__fremovelockftrylockfile<L ,04`hL $(T\ $(T\ $(T\`t\`L lookuppnodeFileLock_ext_offsetPTHREAD_MUTEX_DEFAULT_seek_flags_writepthread_mutex_tfileshort intvalue_closelock_table_lookupPTHREAD_MUTEX_RECURSIVE_NP_nbuffloatlong long intlong int_blksizeftrylockfilePTHREAD_MUTEX_NORMALoff_tpthread_mutexattr_tnode_lockTable_oncePTHREAD_MUTEX_ERRORCHECK_NP__sbufLockTable/u/raghu/ics_feb29flockfileunsigned charlock_table_init_readhashlock_table_locksigned charlong long unsigned intuint32_tunsigned intbuckets__fremovelockmutexshort unsigned int_cookie_base_lbfsizecharlockfpos_t_lockTablelock_table_unlocklong unsigned intdouble__kernel_off_t__uint32_tattrPTHREAD_MUTEX_ERRORCHECKbionic/libc/stdio/flockfile.c_filePTHREAD_MUTEX_RECURSIVEGNU C 4.4.3FILEfunlockfile_ubuf_sizenext__sFILEGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.lock_table_init.rel.text.flockfile.rel.text.funlockfile.rel.text.__fremovelock.rel.text.ftrylockfile.bss._lockTable_once.bss._lockTable.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 0'()>Lp+^p#Z X') np Tj X,() ~ z ,@)  L ,) X-p)  -x) @.p)p .P)'L# /()5p1 (/ )DpS@ H2)Xp#@T P20)!kpcHg 2)#yp00o8#* &&    /:!#%&'JSZmtL~ bionic/libc/stdio/flockfile.clock_table_init_lockTable_lockTable_once_gp_dispmallocpthread_mutex_initmemsetflockfilepthread_oncepthread_mutex_lockpthread_mutex_unlockpthread_mutexattr_initpthread_mutexattr_settypefunlockfile__fremovelockfreeftrylockfilepthread_mutex_trylock "@(`)+ !%,3:AMZahov})7Sao}  #/=Kfy !( , 05CK O Ser{            " 3;?CUbkov{%)05?DNW[pt%)>BSWfjy  i  48 , LP !8 #, < 4 HP $X@ \   % $ &  '  8 %, # 0 ( <D $L4 Pl % % %, # 0 ( <D $L4 Pl % % * *, # 0 ( <D $L4 P % % , 04 X\x| 4 \|     $ , 0 @ D K O V Z i m t x                 %)8<CGVZaetx-19=MQX\cgvz  (0       $ 048<HLPT`dhlx|    $ (,048<fopen.o/ 1331265331 1002 1002 100644 5696 ` ELF@ P4(!0% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I4: ; I4: ; I? < ?3intmr2Og^ a C%NUW X# Y)#>Tw _px# _ry)# _wz)# <{E# X|E# _bf}# ~)# *}# ,# \1#$ Q#( #|#, C#0 _up#8 _ur)#< #@ y#C _lb#D )#L M#P ) } )1 } ) Q } )7 )q } q )w W>>b""m+q +qIfp-"\f.)/)H/)00 bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefopen.cposix_types.htypes.hstdio.hunistd.h+$EOzJgvpJMKKK JqJLKKK J>j<'!',($ !! ' @!@!,!($ 0' @!@! @ $@0 $,( `! !( $, | P0P | P0P0 0T0Tbdb 0UD\`t|`|R`DPRRR<XadpRpaDdhhWhCfopen__page_sizeoff_t/u/raghu/ics_feb29fpos_t_closebionic/libc/stdio/fopen.c_offset__sbuf_readFILEfloatfileunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoublefopenunsigned intflagslong long unsigned int_seekmodelong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extoflagslong int_file__kernel_off_tsigned char_nbuf_size_lbfsize__page_shiftGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fopen.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pyCZ  npj h ~z pP p0 0 p @p! p=  p] 0p0m0 o * h  H`    !*39>FOWbionic/libc/stdio/fopen.cfopen_gp_disp__sflags__sfpopen__sread__swrite__sseek__sclose !%3:AHOV]dkry!=KYgu         )6 $ d |              $ + / 6 : I M \ ` g k r v }                         fprintf.o/ 1331265331 1002 1002 100644 4864 ` ELF P4(!(% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ; ' I@: ; I4: ; I4: ; I !wVCvintYd@(}h aCN &W X# YE#0 Tw _px# _ryE# _wzE# M{7# b|7# _bf}# ~E# ;# "# 5B#$ b#( 4#, T#0 _up#8 _urE#< #@ #C _lb#D E#L -#P E"  EB E( b EH E  Eh00;FfNE@fp& fmt&3ret(Eap)dI bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefprintf.cstdarg.hposix_types.htypes.hstdio.h*tKI <'!'$0'04 !0@$(' | @P(D | @P(D@( 4T 4U$fprintf@@off_t__builtin_va_listfpos_t_close__sbuf_offset_readFILEfloatva_listfprintfunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdouble__gnuc_va_listbionic/libc/stdio/fprintf.cunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fprintf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pt$Z  nphj ` ~@z h p@( h( pF @p p  p p0$0o   7   @ %.bionic/libc/stdio/fprintf.cfprintf_gp_dispvfprintf !%,3:AOV]dkry$2N\jx     V          $ 3 7    fpurge.o/ 1331265331 1002 1002 100644 5168 ` ELF| P4(!(% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@: ; I4: ;I? < /u uA-intWo"f aC@N]W X# YE#0Tw _px# _ryE# _wzE# K{7# `|7# _bf}# ~E# 9}# G# d1#$ Q#( '|#, R#0 _up#8 _urE#< #@ #C _lb#D E#L U#P E } E1 } E Q } E7 Eq } q Ew W00j& 'E#. # _ub$# %#N[Efp, E bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefpurge.cposix_types.htypes.hstdio.hwcio.hfileext.h,NHLHLKK9t>=<'!'$ "$@! &`0D@& 0@ '1!"@ ! !$ (' $ !   $E$ | P(L | P(L( 0T0``3fpurgeoff_t_size/u/raghu/ics_feb29wchar_io_datashort unsigned intfpos_t_closefpurge_offset__sbuf_readFILEfloatsigned charunsigned charlong unsigned intdummy__isthreaded_blksize_ubuf_wcio__sFILEdoubleunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tbionic/libc/stdio/fpurge.c_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fpurge.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p[3Z  npj P ~z XH p0 0 p I PpU pr  p p00A oS c   d\    #,9>JTbionic/libc/stdio/fpurge.cfpurge_gp_disp__isthreadedfreefunlockfileflockfile__errno !%,3:AOV]dkry!=KYgu    %  P              $ + / 6 :    fputc.o/ 1331265331 1002 1002 100644 5132 ` ELF( P4(!% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .: ;' I : ;I.? : ; ' I@ : ; I1RUX Y 14: ;I? < 9 ; ]m)int?{gN aC%NUW X# YE#0Tw _px# _ryE# _wzE# 3{7# H|7# _bf}# w~E# !}# ,# \1#$ Q#( |#, :#0 _up#8 _urE#< #@ i#C _lb#D E#L 3#P E } E1 } E Q } E7 Eq } q Ew W00boE_cE_pE.c&Efp&` (E bionic/libc/stdiobionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysfputc.cstdio.hposix_types.htypes.h'<}<'!!f !$ lB0%k *8VN $(! @ !(` |  |   T 8R8HYHTRTdRdhZhtYtR U TSTXUXS=fputc @Toff_t_size/u/raghu/ics_feb29fputcfpos_t_close_offsetbionic/libc/stdio/fputc.c__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf__sputc_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fputc.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 4>xLpx^p=Z < npj  ~z ( p8  X  px p  p(  pH( 0p0p0o  P  D    !*7<bionic/libc/stdio/fputc.cfputc_gp_disp__isthreadedputc__swbuf !%,3:AOV]dkry!=KYgu     /  H t          ! % , 0 7 ; B F M Q ` d k o v z          fputs.o/ 1331265331 1002 1002 100644 5412 ` ELFD P4(!|H% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ &.? : ; ' I@: ; I4: ; I 4: ;I? < 4!int qj@L aC<NXW .X# YE#0Tw  _px# _ryE# _wzE# e{7# z|7# _bf}# ~E# L}# C# _<#$ z\#( E#, l#0 _up#8 _urE#< #@ #C _lb#D E#L J#P E }  E< } E" \ } EB E| } | E b00e& T'# 4(# * ]+# ,E# p-E#REs+|!fp+4uio-Xiov.Pret/ERET bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefputs.cstddef.hposix_types.htypes.hstdio.hfvwrite.h0MFKHKHKK>7<'!'D@< !'$ $`(!   '0 ! 0D@<H' !  | PHL | PHL 4T 4U4aa%fputsbionic/libc/stdio/fputs.csize_t/u/raghu/ics_feb29iov_lenfpos_t_close_offsetfputs__sbuf_readFILEfloatuio_resid_seeklong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEunsigned chardoubleshort int__suiounsigned intlong long unsigned int__siovoff_tlong long int_baseGNU C 4.4.3char_write_cookieiov_baseuio_iov_flags_extlong int_file__kernel_off_tsigned charuio_iovcnt_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fputs.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^poZ  np j D ~z L8 pH0 x0 p] `p p!  pA p0Q0 o . l  ,_    !*1>IUbionic/libc/stdio/fputs.cfputs_gp_dispstrlen__isthreaded__sfvwritefunlockfileflockfile !%,3:AOV]dkry,HVdr'2 6 : K Y a  $ X t         ! % 4 8 ? C J N    fread.o/ 1331265331 1002 1002 100644 8948 ` ELFtP4(# @% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I4: ; I U.: ; ' I@ 4: ;I? < 4: ; I? < 4Er'int mb@L aC:NPW .X# YE#0Tw  _px# _ryE# _wzE# |{7# |7# _bf}# ~E# j}# A# W<#$ \#( X#, #0 _up#8 _urE#< #@ #C _lb#D E#L H#P E }  E< } E" \ } EB E| } | E b00]& 'E#_ # _ub$# %#buf0}!h0!0fp0+ 2up3 r4E5lenEV(E4fp(EBE~i bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefread.cstddef.hposix_types.htypes.hstdio.hwcio.hfileext.hlocal.h0 8uJ wJKIKINF> 0GMrJJ,tKKIIIKL< OI=IK wJ sJC<=!KIMGMFN^<j>O< %tSKI(? <'!'<840,($ p!!!H !Q@cS` e0+! t+! N!0e !b!Tx ! `@##6 ! `#6@<!840,($ @'<f!  b`C0 i0/ !(@z$<!!840,($ @' ! ca e0`<fe !0de!#v@c ! `<j0*@k00fČ @c& 0f e!0d0(! $$yd!( !0 n$hd  !3@ c# 7`@M4 m ! ` $ $N< $%PK j $% h $1 0 g ! `!  ! `h$ w@@o4 u4 u ! `#4r@Vo0 B4 bC0 o ! ``@ x`3 b`<'! $ 0b!  | ,P@d  4 | ,P@d  D4 PTPee$eTeheee PUPb$bUbb PVP`$\`d`H`P|`` PWPc$cWcc<afa$aaflaldhahdadaeelehtexeeRRlRRhRRR 4Tfread$4hh4off_tlflushresidwchar_io_datacountshort unsigned intfpos_t_close_offset__sbuf_readFILEfloatsizelong unsigned intdummysize_t__isthreaded_blksize_ubuf_wcio__sFILEunsigned chardouble__sdidinitbionic/libc/stdio/fread.c_sizeunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write__sfileext_cookieshort int_flags_exttotallong int_file__kernel_off_tsigned char_nbuffread_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fread.rel.text.lflush.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>LpY^pZ ! npj ! ~\z ! X 4 !p P  ! P !p,  !p "!p( "!p.0 "@!p0^ 0+o=M&P" <   4" (1>HOYepx}bionic/libc/stdio/fread.clflushfread_gp_disp__isthreadedflockfilememcpy__srefillfunlockfile__sdidinit__sinitfree__errno_fwalk__sflush__sflush_locked   !%,3:AOV]dkry,HVdr   $)38BPU_lz  v r P \    0 < `  4    ! "`  4 #  #( $  D H  H     ! % , 0 7 ; B F M Q X \ c g n r y }                           + / 6 : A E L P W [ b f u y                             " & - 1 8 < C G V Z a e l p w {                  $ freopen.o/ 1331265331 1002 1002 100644 8496 ` ELFP4(!@% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I? < 4: ;I? < W.int}OC c a CbNxW QX# Y)#>Tw _px# _ry)# _wz)# {E# |E# _bf}# ~)# h}# i# 1#$ Q#( <|#, #0 _up#8 _ur)#< #@ #C _lb#D )#L p#P ) } )1 } ) Q } )7 )q } q )w W>>A& ')# # _ub$# %#1q!71qvfp1f3)4)>4)4)4)74)0p0)B) bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefreopen.cposix_types.htypes.hstdio.hwcio.hfileext.hunistd.hlocal.h14FN KuCFKMzJKML? =<pJMKKK JqJLKKK J,pJJrIJK wJ JwJ JPKr<tmKGM <X<'!'<840,($ !! ' !@!@b@d g@ $F0  +!  $c@!@ U|6!  1``0D @ & 0@0D@ DH  !  !( @ ! !  3$,( 8v< ! <!840,($ @' !  $$!A!@&  1U`  dv ! r! !( $   H$ J $I Uk !  U!+S !N  !  $!@ ! !n !  !U< | (P@` | (P@` @T@eehee(e0e DU LVL``fRff<DfDLRLffR0fhffPXbX`R`bbbbRbdd8d0dDddX$Xh0XhXXeehee(0eea a4a0a@aafreopen__page_sizeoff_tbionic/libc/stdio/freopen.c/u/raghu/ics_feb29wchar_io_datashort unsigned intfpos_t_close_offset__sbuf_readFILEfloatfileunsigned char__isthreaded_seeklong unsigned intdummyfreopen_blksize_ubufoflags__sFILEdouble__sdidinitunsigned intflagswantfdlong long unsigned intmode_writelong long int_baseGNU C 4.4.3char_cookie__page_shiftshort int__kernel_off_t_flags__sfileext_extsverrnolong int_fileisopensigned char_wcio_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.freopen.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 0>xLpx!^pZ 8 nphj P ~0z X p < `L < pp  xpS !pq  !p !p00o  t    %.7BOYbgotybionic/libc/stdio/freopen.cfreopen_gp_disp__sflags__sdidinit__isthreadedflockfile__sflushopen__errnofreedup2close__sread__swrite__sseek__sclosefunlockfile__sinitfclose !%3:AHOV]dkry!=KYgu    ( 6 C HR Wa fp u   4 X d p       H p   ! " # $ % H L l  &   #  |  ' %        ! % , 0 7 ; B F M Q X \ c g v z                            $ + / > B I M T X _ c j n u y                           # ' 7 ; B F M Q X \ c g n r                fscanf.o/ 1331265331 1002 1002 100644 4856 ` ELF P4(!(% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ; ' I@: ; I4: ; I4: ; I ui:int_w[(}D aC3N AW X# YE#0 Tw _px# _ryE# _wzE# S{7# h|7# _bf}# ~E# 2# :"# PB#$ b#( +#, Z#0 _up#8 _urE#< #@ #C _lb#D E#L H#P E"  EB E( b EH E  Eh00VafnE@fp& fmt&3ret(Eap)cH bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefscanf.cstdarg.hposix_types.htypes.hstdio.h*tKI <'!'$0'04 !0@$(' | @P(D | @P(D@( 4T 4U$fscanf@@off_t__builtin_va_listbionic/libc/stdio/fscanf.cfpos_t_close__sbuf_offset_readFILEfloatva_listunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdouble__gnuc_va_listunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write_cookieshort int__kernel_off_t_flags_extlong int_filefscanfsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fscanf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pt$Z  npgj X ~@z ` p@( xh( pF @p p  p p0#0o  4   @ #,bionic/libc/stdio/fscanf.cfscanf_gp_dispvfscanf !%,3:AOV]dkry$2N\jx     U          $ 3 7    fseek.o/ 1331265331 1002 1002 100644 11052 ` ELFP4(# % RU$ > : ; I$ >  $ >  I : ;  : ; I8 I !I/ : ; I8 ' II&I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I  : ;  4: ; I.? : ; ' I@ 4: ;I4: ; I? < 4: ;I? < oZint;tLP|X+2 lCUh- @.s# /# ,1e# f3;# G4;# 6s# 7s#$ A9s#( :#, <^#8 >s#@ ?s#D As#H zBs#L !Ds#P Es#T qGs#X Hs#\ Je#` s N W  9X # Y)#ITw3 _px # _ry)# _wz)# 2{P# O|P# _bf}# ~)# # C# 3c#$ I#( 9#, #0 _up #8 _ur)#< #@ `#C _lb#D )#L *#P )C3 )c)I )i )) I  I n& ')#f ## _ub$# Z%#s)fp1!1k1)3 4u 4n50st6~7)Po to))=fpl)off ; ;?) B) bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefseek.cstddef.hposix_types.htypes.hstat.hstdio.hwcio.hfileext.hunistd.hlocal.h18xJRxJR %~JJ~JJ~$zJIJ>=;NKFMGMKR0J,IAKQ>MQIK ILIJKIKIKKKILIK~(RLKU<IKv=IK~IKKKIK/z$KILpy^psZ !! npj $! ~ z $!  t%!p(P % !xP %!p %0!p' *!p( *!p  + !p0# 0o&P"      "+6CMUalt}bionic/libc/stdio/fseek.cfseeko_gp_disp__sdidinit__isthreadedflockfile__errnofunlockfile__smakebuf__sseek__sflushfreefstat__sinit__srefillfseek $ !%1>ELSZahov}-;IWesESo}%%0 4 8 J OY ^h mw |           ", >KXf  8 X d         h  ! ! $ `  "h    # d    D H  H     ! % , 0 7 ; B F M Q X \ k o v z                            $ + / 6 : A E L P W [ b f u y                             " & - 1 8 < C G N R Y ] d h o s z ~                             ' + 2 6 = A P T [ _ f j q u |                      fsetpos.o/ 1331265331 1002 1002 100644 4420 ` ELF|P4(!`% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@ : ; ID Tqint1k:E aC'N5W X# YE#0Tw _px# _ryE# _wzE# %{7# ?|7# _bf}# f~E# }# .# `1#$ Q#( |#, ,#0 _up#8 _urE#< #@ `#C _lb#D E#L <#P E } E1 } E Q } E7 Eq } q Ew W00fEiop(pos(  bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefsetpos.cposix_types.htypes.hstdio.h(<'! !0 |   |   T Ufsetposoff_t_size/u/raghu/ics_feb29fsetposfpos_t_close__sbuf_offsetbionic/libc/stdio/fsetpos.c_readFILEfloatunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3_write_cookieshort int_flags_extlong intchar_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fsetpos.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 \>xLpx^pJZ d` npDj  ~z  p   @  p`&  p p  $p 4p0o0CoUe   $5    %.bionic/libc/stdio/fsetpos.cfsetpos_gp_dispfseeko !%,3:AOV]dkry!=KYgu                ftell.o/ 1331265331 1002 1002 100644 5964 ` ELF, P4(# (% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I : ; .? : ; ' I@ 4: ; I4: ;I? < ~oz;2intQt` aCENbW X# YE#0Tw _px# _ryE# _wzE# E{7# Z|7# _bf}# ~E# 3}# L# i1#$ Q#( !|#, L#0 _up#8 _urE#< #@ {#C _lb#D E#L S#P E } E1 } E Q } E7 Eq } q Ew W00o$& 'E#( # _ub$# %#[<7fp*7 pos,IoutRasfp]7pos_aE bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeftell.cposix_types.htypes.hstdio.hwcio.hfileext.h*$ PIK vm=IKzwv <'!'$ (<@!%4 !  D0"PG0L00  H#I< #K/$ ! $!@ ('@#hN!M($ !($F!@   $$C<'!  | <P(P  | <P(P 4<( 0T0`<``bbbR b <b T#ftello=ftell$<<off_tchar_size/u/raghu/ics_feb29wchar_io_datashort unsigned intfpos_t_close_offsetftello__sbuf_readFILEfloatunsigned charlong unsigned intdummy__isthreaded_blksize_ubuf_wcio__sFILEdoubleunsigned intlong long unsigned intftell_seeklong long int_baseGNU C 4.4.3_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbufbionic/libc/stdio/ftell.c_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.ftello.rel.text.ftell.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp%^pZ ! np?j ! ~\<z @!  !p@  !@ <!p0 L!p' !p( !p%  , !p0=  0 o  &" e   < "+8BKW_bionic/libc/stdio/ftell.cftello_gp_disp__isthreadedflockfile__sflushfunlockfile__errnoftell  !%,3:AOV]dkry!=KYgu    ' 2 ?J N c t  0 < @   8    4 8  8      $ + / 6 : I M T X _ c j n u y           funopen.o/ 1331265331 1002 1002 100644 5296 ` ELF P4(!0% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@: ; I: ; I 4: ; I4: ; I&=+D qKintak7p aCN-W %X# YE#0Tw _px# _ryE# _wzE# U{7# j|7# _bf}# ~E# C}# &# `1#$ Q#( <|#, \#0 _up#8 _urE#< #@ #C _lb#D E#L 4#P E } E1 } E Q } E7 Eq } q Ew W00fi33'9 '1I(|g)Q<)fp+3,E? bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefunopen.cposix_types.htypes.hstdio.h) ,NEIKLKKKLtx=<'!',($$ $ @$D@$ PH$E,F(G D,(0'$ F $C! | P0H | P0H0 4T\`TT 8UpU <VtV <WxWXRR,``Afunopenoff_t_size/u/raghu/ics_feb29fpos_t_close__sbuf_offsetclosefnbionic/libc/stdio/funopen.c_readFILEfloatunsigned charseekfn_seeklong unsigned intcookieshort unsigned int_blksize_ubuf__sFILEdoublefunopenunsigned intflagslong long unsigned intwritefnreadfnlong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.funopen.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p|AZ  npj X ~z `  pL, x, p p p  p p00k o}    \<    %.4bionic/libc/stdio/funopen.cfunopen_gp_disp__sfp__errno !%,3:AOV]dkry!=KYgu        $.  ,          $ + / 6 : I M T X g k r v                fvwrite.o/ 1331265331 1002 1002 100644 8972 ` ELF<P4(!@% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ &.? : ; ' I@: ; I4: ; I4: ; I4: ; I : ;  4: ; I:T>S intF~0 L aCNhW fX# YE#0vTw  _px# _ryE# _wzE# {7# |7# _bf}# 1~E# l}# # <#$ \#( )#, #0 _up#8 _urE#< `#@ #C _lb#D E#L #P E }  E< } E" \ } EB E| } | E b00~L& '# 6(#o * )+# ,E# t-E#]0E fp0 !uio0`len2p3|iov4w5E\s5Enl67Et7EerrLofpqERxV bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefvwrite.cstddef.hposix_types.htypes.hstdio.hfvwrite.h0<xJR JxJH JItKIKHKKIQJhHHL\J~0KII*#`!X,+!E!$>7#!@($*h $t@./! ^#! #75"$!(@ !0#!0u& ! @\ 2&v$  $C1$ | 0P@h   | 0P@h   LTLaT a,a LULdUd,d|``,`|bb,bpxXxcXcc,0X0cXcReLRLlRlee0ee8V<DeDLRLeReV0e4ehxgg0pggLgLXhXghtnn0nLnLnh|f f,\f`fLfLf(nhtnnLnnnLnggLg%__sfvwriteuio_iovcntsize_tlong long unsigned intuio_iov_lbfsizeGNU C 4.4.3long long intsigned char_ubuf_base_cookieuio_residlong int_flags_blksizedouble_offsetbionic/libc/stdio/fvwrite.coff_t_readfpos_tunsigned intnldist_closelong unsigned int_fileblenshort unsigned intiov_base_writefloatiov_lenunsigned char__siovshort int__sfvwrite__sbuf__suio__sFILEFILE_seekchar_size_ext__kernel_off_t/u/raghu/ics_feb29_nbufnlknownGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__sfvwrite.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx%^pZ 0 np|j  ~4z x p D L$ D \ph { dp! "p  "p$ "p040 od  4`    (1;BIPXbionic/libc/stdio/fvwrite.c__sfvwrite_gp_disp__swsetupmemcpyfflushmemchrrealloc__errno !%,3:AOV]dkry,HVdr'2 6 : L [ j w           c \   <     $    `         ! % , 0 7 ; B F M Q ` d k o v z                          ! ( , 3 7 > B I M \ ` g k r v }                             # * . 5 9 @ D K O V Z a e t x                            " ) - 4 8 ? C R V ] a h l    fwalk.o/ 1331265331 1002 1002 100644 5152 ` ELF P4(!??8% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I4: ; I? < t hW*wintEeLNY aC$N:W X# zYE#0Tw _px# _ryE# _wzE# 4{7# S|7# _bf}# ~E# "}# +# A1#$ Q#( |#, @#0 _up#8 _urE#< #@ t#C _lb#D E#L 2#P E } E1 } E Q } E7 Eq } q Ew W00GR ' (# )E# ;*#(ET(d fp*In+E\ret+Eog, Ed T- bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefwalk.cposix_types.htypes.hstdio.hglue.h(0zJOLJJKIJ$<'!'40,($ !!$1&  ! @1&!Ȁ %B3T&4!@0,($ 8' | (P8\ | (P8\8 @T@dT@`@a<b4ex_fwalkoff_tnext/u/raghu/ics_feb29niobsfpos_t_close_offset__sbuf_readFILEfloatglueunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILE__sgluedoublebionic/libc/stdio/fwalk.cunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3_fwalk_write_cookieshort int_flagsiobs_extlong intchar_file__kernel_off_tsigned char_nbuf_size_lbfsizefunctionGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text._fwalk.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 x>xLpx^pjxZ  npj 0 ~z 8 px< P< `p hp p  p p00d ov    D3    "+bionic/libc/stdio/fwalk.c_fwalk_gp_disp__sglue !%,3:AOV]dkry!=KYgu    & 3 B O k 0         $ + / 6 : I M \ ` o s      fwrite.o/ 1331265332 1002 1002 100644 5908 ` ELF P4(!P% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ &.? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ;I? < <'int( yxH L aCPNfW 6X# YE#0Tw  _px# _ryE# _wzE# m{7# |7# _bf}# ~E# T}# W# m<#$ \#( M#, t#0 _up#8 _urE#< #@ #C _lb#D E#L ^#P E }  E< } E" \ } EB E| } | E b00s!& \'# B(# * e+# ,E# ~-E#buf+!+4J+]fp+n-uio.Piov/Hret0EEU bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includefwrite.cstddef.hposix_types.htypes.hstdio.hfvwrite.h1( JvJ JxJKGKH J=IKr<'!'LHD@<pb'$!! $@(! ' 0e0@(#F0L! HD@<P'0 ! 0! 00 |  PPT |  PPT <T \U\`` \V\aaa hWWW,bbR%fwritefwriteoff_tsize_t/u/raghu/ics_feb29bionic/libc/stdio/fwrite.ciov_lencountfpos_t_close_offset__sbuf_readFILEfloatuio_resid_seeklong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEunsigned chardoubleshort int__suiounsigned intlong long unsigned int__siovlong long int_baseGNU C 4.4.3char_write_cookieiov_baseuio_iov_flags_extlong int_file__kernel_off_tsigned charuio_iovcnt_nbufsize_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fwrite.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npXj  ~z 0 p4 4 pH p3  pP  pp  p0 0H oZ j   XZ    #,9DPbionic/libc/stdio/fwrite.cfwrite_gp_disp__isthreaded__sfvwritefunlockfileflockfile !%,3:AOV]dkry,HVdr'2 6 : M R\ ak y   b , \          ! % 4 8 ? C J N ] a h l s w ~                 getc.o/ 1331265332 1002 1002 100644 5576 ` ELF P4(# 0% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@ : ; I.? : ; ' I@4: ; I4: ;I? < #k PRrint2`LA aCN:W X# YE#0Tw _px# _ryE# _wzE# &{7# ;|7# _bf}# b~E# }# &# A1#$ Q#( |#, -#0 _up#8 _urE#< #@ \#C _lb#D E#L 2#P E } E1 } E Q } E7 Eq } q Ew W00GEE@fp+-E)fp6Ic8ErE bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includegetc.cposix_types.htypes.hstdio.h+IK 6>8IK<'!!$@$d <'!',($"@!$`$', ! ,($0' $a !  |  @P0L |  @$P0L (T(4S4@T0 0T0|``LdRptR)'getc_unlockedgetc$@@off_t_size/u/raghu/ics_feb29fpos_t_closegetc_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEdoublegetc_unlockedunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizebionic/libc/stdio/getc.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.getc_unlocked.rel.text.getc.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp ^p'Z ! npj `! ~@z p!   0!p@  !@ !pD !p- !p( !p)  !p0A0 o  ," \a   @ (19>KWbionic/libc/stdio/getc.cgetc_unlocked_gp_disp__srgetgetc__isthreadedfunlockfileflockfile  !%,3:AOV]dkry!=KYgu          4  \     $ (  (       ) - 5 9 I M T X _ c r v }        getchar.o/ 1331265332 1002 1002 100644 4992 ` ELF P4(!% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@ .? : ; ' I@ !4: ; I? < 4: ;I? < g[^'int=yXL aC0NFW X# YE#0Tw _px# _ryE# _wzE# 1{7# F|7# _bf}# ~E# }# 7# M1#$ Q#( |#, 8#0 _up#8 _urE#< #@ #C _lb#D E#L >#P E } E1 } E Q } E7 Eq } q Ew W00S FE@EXlE bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includegetchar.cposix_types.htypes.hstdio.h*< 7 <'!b$@$ <'!b @$ %   |  @ X |  @ $X/getchar_unlockedgetchar$@X@Xoff_t_sizegetchar_unlocked/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned char__isthreadedlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int_seekgetcharlong long int_baseGNU C 4.4.3char_write__sF_cookieshort int_flags_extlong int_file__kernel_off_tsigned charbionic/libc/stdio/getchar.c_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.getchar_unlocked.rel.text.getchar.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 >Lp^pZ 0x npj  ~@z   X 8p,0  \0 0p3 @p( Hp ` p0 0o#  ^   @ .7<DXLYbionic/libc/stdio/getchar.cgetchar_unlocked_gp_disp__sF__srgetgetchar__isthreadedgetc  !%,3:AOV]dkry!=KYgu       4   @ H L   $ (  (       gets.o/ 1331265332 1002 1002 100644 5612 ` ELFt P4("8% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I!4: ; I? < 4: ;I? < ``,intB{ZQ aC2NHW X# YE#0Tw _px# _ryE# _wzE# 6{7# K|7# _bf}# r~E# $}# 9# O1#$ Q#( |#, =#0 _up#8 _urE#< #@ l#C _lb#D E#L @#P E } E1 } E Q } E7 Eq } q Ew W00UHbuf) c+EIs,nE bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includegets.cposix_types.htypes.hstdio.h)4<KKIxJRxJ Kv,}x warning: gets() is very unsafe; consider using fgets()<'!'40,($ Ž7@!!%! $ $$$G$SF T%&$$ SȎ4 4!0,($ 8'Î `!  !4 | (HP8` | (HP8`H8 DTDeHehRRRR4@RL``4H`getsHH_size/u/raghu/ics_feb29bionic/libc/stdio/gets.cfpos_t_close_offset__sbuf_readFILEfloatunsigned char__isthreadedlong unsigned intshort unsigned int_blksize_ubuf__sFILEgetsdoubleunsigned intlong long unsigned int_seekoff_tlong long int_baseGNU C 4.4.3char_write__sF_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.gnu.warning.gets.rel.text.gets.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ  np#j t z6H |` p<<  x<  p  pe  p   p  p0{ 0+ o= M &! X   H(5:BNbionic/libc/stdio/gets.cgets_gp_disp__isthreaded__sF__srgetfunlockfileflockfile !%,3:AOV]dkry!=KYgu        4 D         4         $ + / 6 : I M T X _ c j n u y          makebuf.o/ 1331265332 1002 1002 100644 7756 ` ELFP4(# ?8% RU$ > : ; I$ >  $ >  I : ;  : ; I8 I !I/ : ; I8 ' II&I.? : ; ' I@: ; I: ; I4: ; I .? : ; ' @4: ; I4: ; I4: ; I? < '/int;Qcq CN lC>h- (.s# /# h1e# 83;# Z4;# 6s# \7s#$ 9s#( :#, )<^#8 >s#@ ?s#D cAs#H @Bs#L Ds#P BEs#T Gs#X Hs#\ Je#` s N{W  oX # Y)#ITw3 _px # _ry)# _wz)# {P# |P# _bf}# ~)# # C# Tc#$ #( 1#, #0 _up #8 _ur)#< #@ V#C _lb#D )#L #P )C3 )c)I )i )) I  I ]Q)7fpQ7!Q=U3QCstS0)u1 fp17p3P4)50P36);;_ bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includemakebuf.cstddef.hposix_types.htypes.hstat.hstdio.hunistd.hMIKKJj<KIsJ JHL1$Krt=zIKKGILLKI9wtKILKL<'!h'! !$"$' '@0pc0 e8, @Ĭ$&$'4"gL$( ($<'!'40,( b0 @!C$$40,(8'' ' !@@    Q6 @ 4%- 0,(8' R6 B C&'5$  | PL P8P | PL4 P8P (T(L`T`` 0U0HaHTUTaa \VVV 8 4T4X``` `HPb|baa bH``x`\ `dZd,__swhatbufI__smakebuf$  size_tlong long unsigned int_lbfsizeGNU C 4.4.3couldbettystatlong long intsigned char__swhatbufst_ino_base__smakebuf_cookielong int_flags_ubuf_blksizedoublebufsize_offsetoff_tst_blocksst_uidfpos_tunsigned int_closelong unsigned int_filesizeshort unsigned intst_atimest_size_writest_modest_mtime_nsecfloat_readst_nlinkunsigned charshort int__sbufst_blksize__sFILE__page_sizest_ctimeFILE_seekst_rdevchar_size_extbionic/libc/stdio/makebuf.c__kernel_off_tst_atime_nsec__pad0__pad1__pad2__page_shiftst_dev/u/raghu/ics_feb29st_ctime_nsecflags_nbufst_gidst_mtimeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__swhatbuf.rel.text.__smakebuf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp4^pZ ! npj t! ~tz  ! P  8!pp P  ! P !p  !p 0 !p ( !p  , ! p02 l0o/h" X{    (17? JQktbionic/libc/stdio/makebuf.c__swhatbuf_gp_dispfstat__sseek__smakebufmalloc__atexit_register_cleanup_cleanupisatty  !%1>ELSZahov}-;IWesESo}%     $ KR V Z l z   l  T  ` x      4 8  8     ! % , 0 7 ; B F U Y ` d k o v z                         ' + 2 6 = A P T \ ` h l s w             mktemp.o/ 1331265332 1002 1002 100644 11796 ` ELF P4(,)   ((% RU$ > $ > $ > : ; I I : ;  : ; I8 I !I/ &I .? : ; ' I  : ; I.: ; ' I@: ; I4: ; I4: ; I4: ; I4: ; I  U.1@1.? : ; ' I@1X Y 14: ; I? < intAN{o8")vHh-.h#/#|1Z#30#G40#6h# 7h#$9h#(:#,h#@?h#DAh#HmBh#L8Dh#P Eh#TGh#XHh#\JZ#` h } VE EU) U! U`eU)U)WtrvWFPWX~'Y)pidZ*cp)P  =P( NH8Pg<PfE =>)P 5fd7)^-)P - -)fd/)1,0089 E%:1 bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includemktemp.cposix_types.htypes.hstat.hstdlib.hunistd.hctype.h<JLK0K JMNgJs{b}e0J0JJJ(x8KIIKIL=t)ipm=x =5wKK-wKKwarning: mktemp() possibly used unsafely; consider using mkstemp()<'!P'!!!r@!B$C`B$B$#Gt&+ d fX$n@ff<gf5h@N<Fï#P@x p !h#`M0%&+H !@ &+p /$s/$&o&'$Z$a$z$ ! $ $A" DÂ`!ht!v !ctg$SUB$C`!' $E!'NLpc^p{Z 4#0* np5j d&0* zB  &p* P ' *4 P $' * P D' * P d' *$P ' *pt '`*<  (0*pE 4( *-pIN) T-* ApH= \-8*"TpPP -*$bp0/3m0bvot+ |"    "$&'(%.6=BGRX^PfPmPuP}Pbionic/libc/stdio/mktemp.c_gettemp_gp_disp__errnogetpidstatopenarc4randomlstatmkdir_mktempmktempmkdtempmkstempmkstemps $@%`&'( !%3:AHOV]dkry .<JXft  ).8=GLVeju      %)-6@GRVZcm{    P  0 `    !   d "h #  ,  ,  ,  $  $  HL dh  L h     ! % , 0 7 ; B F M Q ` d k o v z                          ! ( , 3 7 F J Q U \ ` g k r v }                              * . 5 9 @ D K O V Z a e l p w {                         ( , 4 8 H L S W fjrv "15   (08       $ ( , 048<@Dprintf.o/ 1331265332 1002 1002 100644 4932 ` ELF P4(!(% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@: ; I4: ; I4: ; I !4: ; I? < %zNFnint\\@(}k aCN &W X# YE#0 Tw _px# _ryE# _wzE# P{7# e|7# _bf}# ~E# ># "# 5B#$ b#( #, W#0 _up#8 _urE#< #@ #C _lb#D E#L -#P E"  EB E( b EH E  Eh00;Ff2ETfmt& ret(Eap)9eH bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeprintf.cstdarg.hposix_types.htypes.hstdio.h*tKIKI <'!'$!,',04T$!(` !0@$(' | TP(D | TP(DT( T HS)printfTToff_t__builtin_va_listfpos_t_close__sbuf_offset_readFILEfloatva_listunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdouble__gnuc_va_listbionic/libc/stdio/printf.cunsigned intlong long unsigned int_seek_writelong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29printf__sF_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.printf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p)Z  npij  ~Tz   pp( ( p> @p p  $p; 4p0K0o H  :   T #,1bionic/libc/stdio/printf.cprintf_gp_disp__sFvfprintf !%,3:AOV]dkry$2N\jx    U  $         $ + /    putc.o/ 1331265332 1002 1002 100644 6360 ` ELF P4(# ?(0% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .: ;' I : ;I.? : ;' I@: ; I1RUX Y 14: ; I 4: ;I? <  cG/gintEUAT aCN/W X# }YE#0Tw _px# _ryE# _wzE# 9{7# N|7# _bf}# ~E# '}# # 61#$ Q#( |#, @#0 _up#8 _urE#< #@ o#C _lb#D E#L '#P E } E1 } E Q } E7 Eq } q Ew W00<uE_cE_pGE0c,E fp,82"Ewc;Efp;ret=ERzE bionic/libc/stdiobionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysputc.cstdio.hposix_types.htypes.h-}<=}>$=>p<'!'$  b0@!$@2%$ ('! @  $E$*8H^V $I! $  ('<'!',($ !@!! @ !( ` ! ,($ 0' !  | P(HP0P | P(H0P0P( ,T,d`dlZl`[Z`Z tUU0 8T8pbb 8U8taa)putc_unlocked0putc$8\off_t/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEputc_unlockeddoubleunsigned intbionic/libc/stdio/putc.clong long unsigned int_seek_writelong long int_baseGNU C 4.4.3charputc_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf__sputc_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.putc_unlocked.rel.text.putc.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp(^pZ ! npFj ! ~dz 0! @ 0!pL  ! L !pl (@!p| - h!p ( p!p 8 P!p0 0 o  ,\" Ls    (1;CKP]ibionic/libc/stdio/putc.cputc_unlocked_gp_disp__swsetup__errno__swbufputc__isthreadedfunlockfileflockfile  !%,3:AOV]dkry!=KYgu      2> B F W e x  4 l   $ 8 T    0 4  4      $ + / 6 : A E L P W [ b f m q                              $ ( , putchar.o/ 1331265332 1002 1002 100644 6028 ` ELF P4(# % RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .: ;' I : ;I.? : ;' I@ : ; I4: ; I1RUX Y 1!4: ; I? < 4: ;I? < 0qd=intS^$b aC,NLW X# YE#0Tw _px# _ryE# _wzE# G{7# \|7# _bf}# ~E# 5}# # S1#$ Q#( )|#, N#0 _up#8 _urE#< #@ }#C _lb#D E#L D#P E } E1 } E Q } E7 Eq } q Ew W00YE_cE_pE+c6Eso8:3HEdzc)Ekso+ -0zrE bionic/libc/stdiobionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysputchar.cstdio.hposix_types.htypes.h9=}=} <'! `!\$ `\TB0%T TE$l*0gVN $(! @ T$<'!\c$`\T0D%BTl*0bNF $ T$ |  d |   $d T8R8HYHLRLXTXhRhlZlxYxR ,T,8X8HTHLYLXXXdT/putchar+putchar_unlocked$d@X 08ddoff_t/u/raghu/ics_feb29short unsigned intfpos_tputchar_unlocked_offset__sbuf_readFILEfloatunsigned char__isthreadedlong unsigned intbionic/libc/stdio/putchar.c_blksize_ubuf__sFILEdoubleputcharunsigned intlong long unsigned int_seek_closelong long int_baseGNU C 4.4.3char_write__sF_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf__sputc_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.putchar.rel.text.putchar_unlocked.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp<^pZ ! npuj ! ~z 8! d  !pt0  !0 !p !p3 !p( !pH ,`!p0, 0 "o  2" d^    %.;@EMdbionic/libc/stdio/putchar.cputchar_gp_disp__isthreaded__sFputc__swbufputchar_unlocked  !%,3:AOV]dkry!=KYgu    -9 = Q d h    H L x  X   $ (  (       ! % , 0 7 ; B F M Q X \ k o v z                  $ 0 4 8 < puts.o/ 1331265332 1002 1002 100644 5832 ` ELF@ P4("?P% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ &.? : ;' I@: ; I4: ; I4: ; I 4: ; I!4: ; I? < 4: ;I? < -intomJ9L aC"N8W 'X# YE#0Tw  _px# _ryE# _wzE# c{7# x|7# _bf}# ~E# J}# )# ?<#$ g\#( >#, j#0 _up#8 _urE#< #@ #C _lb#D E#L 0#P E }  E< } E" \ } EB E| } | E b00E & R'# (# * [+# ,E# P-E#~E s+|!c-uio.Hiov/Tret0EJEZES bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeputs.cstddef.hposix_types.htypes.hstdio.hfvwrite.h, JtJ ELHKLKzJLKKKKKKp=vK <'!'LHD !F$(%$$'$$,0 `(T$& ' @ $L $ `!HDP' T$&T$& ' @8 Td%8 $L $ `!HDP' |  PPL |  PPL  0T0taaR R%puts  size_t/u/raghu/ics_feb29iov_lenfpos_t_close_offset__sbuf_readFILEfloatuio_resid__isthreaded_seeklong unsigned intshort unsigned int_blksize_ubuf__sFILEunsigned chardoubleshort intbionic/libc/stdio/puts.c__suiounsigned intlong long unsigned int__siovoff_tlong long int_baseGNU C 4.4.3char_write__sF_cookieiov_baseuio_iov_flags_extlong int_fileputs__kernel_off_tsigned charuio_iovcnt_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.puts.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx)^pZ  np]j  z2  h p(0  X0 ( ph 0p p  p   p+   p0;  0 o  #! g     $-4AFQ[bionic/libc/stdio/puts.c$LC0puts_gp_dispstrlen__isthreaded__sF__sfvwriteflockfilefunlockfile !%,3:AOV]dkry,HVdr'3 7 ; L  `  $ 8 @p t             ! % , 0 7 ; J N U Y    putw.o/ 1331265332 1002 1002 100644 5060 ` ELF P4(!|8% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ &.? : ;' I@: ; I4: ; I ~  {int ]i,Ll aCANWW X# YE#0Tw  _px# _ryE# _wzE# Q{7# f|7# _bf}# ~E# 8}# H# ^<#$ y\#( 1#, X#0 _up#8 _urE#< #@ #C _lb#D E#L O#P E }  E< } E" \ } EB E| } | E b00d& @'# 9(# * I+# ,E# o-E#]E\{w&E fp&{?uio(hiov)`xS bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeputw.cstddef.hposix_types.htypes.hstdio.hfvwrite.h&zHKMxJQIKGNGM <'!'4'8'$8$ $!  ' (48' | \P8D | \P8D\8 0T0\8 HU%putw\\off_tsize_t/u/raghu/ics_feb29bionic/libc/stdio/putw.ciov_lenfpos_t_close_offset__sbuf_readFILEfloatuio_resid_seeklong unsigned intshort unsigned int_blksize_ubuf__sFILEunsigned chardoubleshort int__suiounsigned intlong long unsigned int__siovlong long int_baseGNU C 4.4.3char_write_cookieiov_baseuio_iov_flags_extlong int_file__kernel_off_tsigned charuio_iovcntputw_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.putw.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 d>xLpx^p^Z l np|j  ~\\z  p( 4( DpR LPpZ pu  p p00Q oc s   03   \ (bionic/libc/stdio/putw.cputw_gp_disp__sfvwrite !%,3:AOV]dkry,HVdr'3 7 ; L Z ` $         $ + / ? C    refill.o/ 1331265332 1002 1002 100644 6164 ` ELF P4(#  % RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I.: ; ' I@ 4: ; I? < W-X4intny9} aCGN]W 'X# YE#0Tw _px# _ryE# _wzE# b{7# w|7# _bf}# ~E# P}# N# d1#$ Q#( >|#, i#0 _up#8 _urE#< #@ #C _lb#D E#L U#P E } E1 } E Q } E7 Eq } q Ew W00t&& 'E#E # _ub$# %#j4Efp4 (E4Mfp(_BEW bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includerefill.cposix_types.htypes.hstdio.hwcio.hfileext.hlocal.h4@ K=IK KXIKKI%J<J><nKIKMGMFNIMMKIbIKIKK(? <'!'bB@! b0 D08E0 F0iJ0W@n4 ^@ C08`$  ߬1\  %@ ! '0D@& 0<@8! '$ ' @@o4 n4 $ $%HJ%   $0 0  !  $ ! @ 1\   !   $@'5H $<'! $ 0b!  | P H 4 | P H 04 ,T,``(`0` 4T[__srefill$44off_tlflush_size/u/raghu/ics_feb29wchar_io_datashort unsigned intfpos_t_close_offset__sbuf_read__srefillFILEfloatbionic/libc/stdio/refill.cunsigned charlong unsigned intdummy_blksize_ubuf_wcio__sFILEdouble__sdidinitunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__srefill.rel.text.lflush.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp^p[Z ! np[j ! ~Hz `! d4 !p< $ !< D!p r T!p  !p ( !p   !p0 0 o  *P" `   4# -6AJUZbiqbionic/libc/stdio/refill.clflush__srefill_gp_disp__sdidinit__sflush__smakebuffree__sinit_fwalk__errno__sflush_locked   !%,3:AOV]dkry!=KYgu  $/ 3 HN K  X l  0 ` | h   (   0 4  4      $ + / 6 : A E L P _ c       remove.o/ 1331265332 1002 1002 100644 4512 ` ELFPP4(!<% RU$ > $ > $ >  I&I : ;  : ; I8 I !I/ .? : ;' I@ : ; I 4: ; I 4: ; I? < Mkint?nYh-u.h#/#S1Z#3L#B4L#86h# |7h#$t9h#(:#,Kh#@ ?h#DZAh#HBh#LDh#PEh#TcGh#X;Hh#\JZ#` h } E |(! st*L^L~ bionic/libc/stdiobionic/libc/include/sysbionic/libc/includeremove.cstat.hunistd.hstdio.h(v>8N<'!x'' ! @0@$0 b ! '$' ! ' | PH | PH ,T,X``l`t`remove__page_sizest_atime_nsecstat/u/raghu/ics_feb29st_atime__pad2st_nlinkst_sizest_inost_mtimest_blksizefloatst_rdevfileunsigned charst_blockslong unsigned intst_modeshort unsigned intremovedoublest_ctimeunsigned intlong long unsigned intst_ctime_nsecst_mtime_nsecbionic/libc/stdio/remove.cst_uidlong long intGNU C 4.4.3char__page_shiftshort intst_devst_gid__pad0__pad1long intsigned charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.remove.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 X>xLpx^p5Z `p npEj  ~z ( px, , pU `p% xpB  pb p0r0o*:x   ?    #,29bionic/libc/stdio/remove.cremove_gp_displstatunlinkrmdir !%,3:AOV]dkry+9GUcq      D t        ! % , 0 7 ; B F    rewind.o/ 1331265332 1002 1002 100644 4796 ` ELFT P4(!| % RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' @: ; I4: ;I? <  4 _o+intA}iP aC&NWW X# YE#0Tw _px# _ryE# _wzE# 5{7# J|7# _bf}# q~E# #}# -# ^1#$ Q#( |#, <#0 _up#8 _urE#< #@ k#C _lb#D E#L O#P E } E1 } E Q } E7 Eq } q Ew W00dfp& E bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includerewind.cposix_types.htypes.hstdio.h&uKK<'!'!(!0 !b @ 0  @ ' !  @ ' | P H | P H 0T0\`h`rewindoff_t_size/u/raghu/ics_feb29rewindfpos_t_closebionic/libc/stdio/rewind.c_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__isthreaded_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.rewind.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 |>xLpx^pYZ h npDj  ~z 8 p, ,, <p I DPpU pr  p p0z0o.>|  ,P    #,2?Gbionic/libc/stdio/rewind.crewind_gp_dispfseek__isthreaded__errnoclearerr !%,3:AOV]dkry!=KYgu      4 @ h x         $ + / 6 :    rget.o/ 1331265332 1002 1002 100644 4584 ` ELFP4(!< % RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@: ; I QUuint3cO B aCN=W X# YE#0Tw _px# _ryE# _wzE# '{7# <|7# _bf}# c~E# }# &# D1#$ Q#( |#, .#0 _up#8 _urE#< #@ ]#C _lb#D E#L 5#P E } E1 } E Q } E7 Eq } q Ew W00J-wEhfp+  bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includerget.cposix_types.htypes.hstdio.h+=KIK <'!' ! @$C$B '$ ' | hP H | hP Hh (T(P`X``__srgethhoff_t_size/u/raghu/ics_feb29fpos_t_close__srget_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned intbionic/libc/stdio/rget.c_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__srget.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pJZ ` np+j 8 ~hz @ p\, X, hpI pPp p  p; p0Kl0o  5   h "+bionic/libc/stdio/rget.c__srget_gp_disp__srefill !%,3:AOV]dkry!=KYgu              $ + / 6 :    scanf.o/ 1331265332 1002 1002 100644 4920 ` ELF P4(!(% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@: ; I4: ; I4: ; I !4: ; I? < %p^T*tint@b@(}O aCN &W X# YE#0 Tw _px# _ryE# _wzE# 4{7# I|7# _bf}# ~E# "# "# 5B#$ b#( #, ;#0 _up#8 _urE#< #@ j#C _lb#D E#L -#P E"  EB E( b EH E  Eh00;FfNEPfmt& ret(Eap)bG bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includescanf.cstdarg.hposix_types.htypes.hstdio.h*t <'!'$!,',04!(` !0@$(' | PP(D | PP(DP( (T(DS)scanfPPoff_t__builtin_va_listfpos_t_close__sbuf_offset_readFILEfloatva_listscanfunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdouble__gnuc_va_listunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write__sF_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbufbionic/libc/stdio/scanf.c_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.scanf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p)Z  npfj  ~Pz   pl( ( p> @p p  p6 (p0F0o @  7   P !*2bionic/libc/stdio/scanf.cscanf_gp_dispvfscanf__sF !%,3:AOV]dkry$2N\jx    T  $         $ + /    setbuf.o/ 1331265332 1002 1002 100644 4404 ` ELFpP4(!% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' @ : ; IRTtint4bN C aC&N<W X# YE#0Tw _px# _ryE# _wzE# ({7# =|7# _bf}# d~E# }# -# C1#$ Q#( |#, /#0 _up#8 _urE#< #@ ^#C _lb#D E#L 4#P E } E1 } E Q } E7 Eq } q Ew W00I fp&buf& bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesetbuf.cposix_types.htypes.hstdio.h&<'!$ 0 $ |  |   T Usetbuf off_tsetbuf_size/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoublebionic/libc/stdio/setbuf.cunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.setbuf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 L>xLpx^pHZ T` np3j  ~ z  p  8  pX&  p~ p  p $p0m08oJZ   4     #,bionic/libc/stdio/setbuf.csetbuf_gp_dispsetvbuf !%,3:AOV]dkry!=KYgu                setbuffer.o/ 1331265332 1002 1002 100644 5060 ` ELF P4(# % RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@ : ; I.? : ;' @ : ; I  hnintJ\QY aC)N?W X# YE#0Tw _px# _ryE# _wzE# >{7# S|7# _bf}# z~E# }# 0# F1#$ Q#( |#, E#0 _up#8 _urE#< #@ t#C _lb#D E#L 7#P E } E1 } E Q } E7 Eq } q Ew W00L_E fp/^ fp%buf%&W%E9 bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesetbuffer.cposix_types.htypes.hstdio.h/%L<'!!($ !8<'!!8$  0 |  |   $ T T U V W+"setlinebufsetbuffer$ off_t_size/u/raghu/ics_feb29setbufferfpos_t_close_offset__sbuf_readFILEfloatsizelong unsigned intshort unsigned int_blksize_ubuf__sFILEunsigned chardoublesetlinebufunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookieshort intbionic/libc/stdio/setbuffer.c_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.setlinebuf.rel.text.setbuffer.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 $!>Lp^p"Z 4! npj ! ~ z !   !p0  !0 $!p(W 4P!p/ !p( !p  ! p00qo.<" E     *3; bionic/libc/stdio/setbuffer.csetlinebuf_gp_dispsetvbufsetbuffer  !%,3:AOV]dkry!=KYgu              $ (  (     & * 9 = D H       setvbuf.o/ 1331265332 1002 1002 100644 8160 ` ELFP4(!H% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@: ; I: ; I4: ; I4: ; I4: ; I  : ; 4: ;I? < ?A j.int+ ~KL aCNlW 9X# YE#0Tw  _px# _ryE# _wzE# |{7# |7# _bf}# ~E# b}# ]# s<#$ \#( P#, #0 _up#8 _urE#< #@ #C _lb#D E#L d#P E }  E< } E" \ } EB E| } | E b00y & 'E#W # _ub$# %#t Efp+!buf+`&+E +ret-E-E./ETnbfjE ` bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesetvbuf.cstddef.hposix_types.htypes.hstdio.hwcio.hfileext.h+ 4vJ  MILMuOd1JO.JHHMGLKHM+( <e:JGIKMRIKz$L^HIzU*J<'!'D@<840,($!!!!A ! 0D @& 0@ f21\$$'$h! ' '*%b ! `@!@!!"s6!C &s6 $   I  D@<840,(H' !  @!!n6&x 1:m6 l2 r2!@#  D @<840,(H' !  ! , `$D ! @!@$l$$s6 | (PH` | (PH` LTLT`T\T\` ` LULbRLbL\U\bb LbTtbtRbRbRb \V\PaPdVdaaT`a`tVtaVa LWL@e@\W\effe TfTxexfeWfR 8RR 8RL`RltRRRRcl c TctccP \PPe P TeT`PtPPsetvbufoff_tsize_t/u/raghu/ics_feb29wchar_io_datashort unsigned intbionic/libc/stdio/setvbuf.c_close_offset__sbuf_readFILEfloatsizefpos_tlong unsigned intiosizedummy__isthreaded_blksize_ubuf_wcio__sFILEunsigned chardoubleunsigned intflagsttyflaglong long unsigned int_seekmodelong long int_baseGNU C 4.4.3char_write__sfileext_cookieshort intsetvbuf_flags_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.setvbuf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx,^pZ  npUj  ~hz  p < `\ < pp 6 x@p  p  p  p00oD  D    %.;ENS^eqbionic/libc/stdio/setvbuf.csetvbuf_gp_disp__isthreadedflockfile__sflushfree__swhatbufmallocfunlockfile__atexit_register_cleanup_cleanup !%,3:AOV]dkry,HVdr    $ 3 8B GQ ` eo t~  m L X \    l    , 0 T |         ! % , 0 7 ; B F M Q ` d k o v z                             # ' . 2 9 = D H O S Z ^ e i p t                             % ) 0 4 ; ? F J Q U \ ` g k r v                           " &    snprintf.o/ 1331265332 1002 1002 100644 5484 ` ELF P4(!% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@: ; I4: ; I4: ; I4: ; I 4: ; I 8Itv3int$n D(}L aCFN TW 2X# YE#0 Tw _px# _ryE# _wzE# {7# |7# _bf}# ~E# n# M-# cM#$ m#( \#, #0 _up#8 _urE#< -#@ #C _lb#D E#L [#P E-  EM E3 m ES E  Es00if & 'E# c # _ub$# %#Estr)!n)?fmt)hap+ret,E-f./m bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesnprintf.cstdarg.hstddef.hposix_types.htypes.hstdio.hwcio.hfileext.h1tREPEKHKKKKIKLzKp<'!x'$!'' '$$\:8<@,4!(,' $ !0@,`'<4$ | PD | PD hTT dUUU tVVtsnprintfoff_tsize_t__builtin_va_listwchar_io_data_ubufshort unsigned intfpos_t_close__sbuf_offset_readFILEfloatunsigned charfextlong unsigned intdummysnprintfbionic/libc/stdio/snprintf.c_blksizeva_list_wcio__sFILEdouble__gnuc_va_listunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.snprintf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np4j l ~z t px( ( p pb Dp  Lp \p00| o    `;    '0bionic/libc/stdio/snprintf.csnprintf_gp_disp__vfprintf !%,3:AOV]dkry/=Ygu & * . = J Y h xz 8        ! % , 0 ? C J N U Y h l s w      sprintf.o/ 1331265332 1002 1002 100644 5160 ` ELF P4(!% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@: ; I4: ; I4: ; I 4: ; I x'8me,int{g3(} aC?N MW !X# YE#0 Tw _px# _ryE# _wzE# o{7# |7# _bf}# ~E# ]# F"# \B#$ b#( K#, v#0 _up#8 _urE#< &#@ #C _lb#D E#L T#P E"  EB E( b EH E  Eh00bf & 'E# R #  _ub$# %# Estr.!fmt.4ret0Eap1f2{3` bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesprintf.cstdarg.hposix_types.htypes.hstdio.hwcio.hfileext.h4xEPzJIIKKKKIKLzJK <'!x' xLpx ^p|Z  npj  ~z  p( <( pdG @p p  p p00 o    9    %.bionic/libc/stdio/sprintf.csprintf_gp_disp__vfprintf !%,3:AOV]dkry$2N\jx  # 2 A lm (        ! % 4 8    sscanf.o/ 1331265332 1002 1002 100644 5632 ` ELF P4("% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .: ; ' I@ : ; I : ; I .? : ;' I@: ; I4: ; I4: ; I 4: ; I >+ms,intg&(}} aC?N MW X# YE#0 Tw _px# _ryE# _wzE# {7# |7# _bf}# ~E# k# F"# \B#$ b#( Y#, #0 _up#8 _urE#< &#@ #C _lb#D E#L T#P E"  EB E( b EH E  Eh00bf & 'E# ` #  _ub$# %#)EP)Tbuf)Ulen)EV Estr0!fmt04ret2Eap3f4{5_ bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesscanf.cstdarg.hposix_types.htypes.hstdio.hwcio.hfileext.h)6wGIKGMHMGMGLKF !<'!p'$'X48(  '$L('<, l' |  PD |  $PD LT @UPsscanf$off_t__builtin_va_listwchar_io_data_ubufshort unsigned intfpos_t_close__sbuf_offset_readFILEfloatunsigned charfextlong unsigned intcookiedummy_blksizeva_list_wcio__sFILEdouble__gnuc_va_listunsigned intlong long unsigned inteofread_seeklong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29bionic/libc/stdio/sscanf.c_write__sfileext_cookieshort int__kernel_off_t_flags_extlong int_filesscanfsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.eofread.rel.text.sscanf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 8 >Lp>^pZ H npj  z4< 0 p8 P 8 p p8G @ p  p(  p  p0 0 o  $D! C    $+4;bionic/libc/stdio/sscanf.ceofreadsscanf_gp_dispstrlenvfscanf  !%,3:AOV]dkry$2N\jx  )R^ b ful |  X T \   $ (  (     ! % 4 8       stdio.o/ 1331265332 1002 1002 100644 7432 ` ELFP4('$ ( % RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@ : ; I.? : ; ' I@4: ; I4: ; I: ; I4: ; I? < %Bint`v1x a C,NdW X# Y)#>Tw _px# _ry)# _wz)# T{E# i|E# _bf}# ~)# D}# 3# k1#$ Q#( 6|#, [#0 _up#8 _ur)#< #@ #C _lb#D )#L \#P ) } )1 } ) Q } )7 )q } q )w W>>q|V)V}:Fl=F}3=F\%F)ofpH=retIo;);}buf;qn;)fp==L,)d,}:buf,cn,)vfp.=ret/)00 bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includestdio.cposix_types.htypes.hstdio.hunistd.h FNINz ;$GMGMK,FN <'! <'!'! $C 4P  ' 0  '<'!'$  !C0!`!!( $ $$D !(@!0 $  ('<'!'! @P!P ' 0  ' |  lP HP(PdP H |  $lP H@P(P`dP H Tl $T$L`Td` ,U ,V8<RDXR( <T<` <U<|b <V<ad $T$D`L\` ,U ,V48R<PR@__sclose__sseekC__swrite__sread4ldld__page_sizeoff_t/u/raghu/ics_feb29whencefpos_t_close__sseekbionic/libc/stdio/stdio.c_offset__sbuf_readFILEfloat__scloseunsigned charlong unsigned intcookieshort unsigned int_blksize_ubuf__sFILEdoubleshort intunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_writeoffset_cookie__sread_flags_extlong int_file__swrite__kernel_off_tsigned char_nbuf_size_lbfsize__page_shiftGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__sclose.rel.text.__sseek.rel.text.__swrite.rel.text.__sread.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5  %>Lp'^pZ P% npj  % ~0z % Hl 8% P %@d p%px @% x  %p  %p; D % p 8 (%p ( @%+p0 60 ?o  O & 0]   !"# $-3l;AJPdXbionic/libc/stdio/stdio.c__sclose_gp_dispclose__sseeklseek__swritewrite__sreadread @` !%3:AHOV]dkry!=KYgu    8EP T Xakz        < `    $ ( @ D ` d  ( D d      # 3 7 > B I M \ ` o s                       & * : > E I P T c g v z        (         tempnam.o/ 1331265332 1002 1002 100644 6080 ` ELF P4(# @% RU$ > $ > $ >  I&I.? : ;' I@: ; I 4: ; I 4: ; I 4: ; I 4: ; I? < _#intH1Ldir-!pfx-` /E f0 C0 L rL] bionic/libc/stdiobionic/libc/includetempnam.cunistd.hstdio.h-,FNwC(td$v($tl$y(xwKc_J!J warning: tempnam() possibly used unsafely; consider using mkstemp()tmp.TMPDIR/%s%s%sXXXXXXXXXX%s%sXXXXXXXXX/tmp/<'!'<840,(!$ !@!@@ %@S  ! !X"j/$FG%%!8 ! $  ! :@!@<!840,(@' $@! @  !(/$b$&%! $  ! @!@<!840,(@'%%! $f&'&  ! @!@f&'&! $  ! @!@ ! P  P<wR&<!!840,(@' | $P@X | $P@X 8T8aaapa @U@bbtbtb`Lp`hxRxdR(`Wt|d|RddWRdR0d0<R<pddtempnamlong long intsverrnounsigned intunsigned charlong unsigned intnamelong long unsigned int/u/raghu/ics_feb29__page_shiftGNU C 4.4.3charbionic/libc/stdio/tempnam.clong intdoubleshort unsigned intsigned char__page_sizetempnamfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.gnu.warning.tempnam.rodata.str1.4.rel.text.tempnam.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 `!>xLpx^p!Z h! np8j X! zC2`D `@!pH8 !8 !pu !p- !pK  ! pk !p0{"0z +o  ;P"    "',1,6<;@HQXbirzbionic/libc/stdio/tempnam.c$LC2$LC4$LC1$LC3$LC5$LC6$LC0tempnam_gp_dispmallocissetugidstrlensnprintf_mktempgetenv__errnofree !%,3:AOV]dkry   j , T !l "  #  $ %  "8 <D #@ Hd $   # $ #   $0 &D 'X &p x       ! % , 0 7 ; B F M Q ` d k o v z                            $ + / 6 : A E L P W [ b f    tmpfile.o/ 1331265332 1002 1002 100644 6480 ` ELF| P4("`% RU$ > $ >  $ > : ; I I : ;  : ; I8 I !I/  : ;  : ; I8 ' II&I.: ; ' I : ; I.? : ;' I@4: ; I 4: ; I 4: ; I4: ; I1RUX Y 1 4: ; I? < " 3intrUsl.0 a? C sig# h AN ZW! X!# Y)#> TwI _px!# _ry)# _wz)# _{E# ||E# _bf}# ~)# M}# HY# ay#$ #( F#, f#0 _up!#8 _ur)#< #@ #C _lb#D )#L #P)Y}I)y})_}))}) >  > g'O[)set[ set/</Hfp0!fd1)Uk1)~buf3Xd8(u=  00' bionic/libc/stdiobionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/systmpfile.csignal.hposix_types.htypes.hsignal.hstdio.hunistd.h-$IKKKK'XK'\<=wyt <wJ JztK/tmp/tmp.XXXXXXXXXXw+<'!'\XTP%%=' ȑfe d'8'fedj8 g c! $ $('!( $ !0@ ! !@$)" !  ! ! @ !@'3 ! !(@$ !0!  &@!@\!XTP`'!(@$ !0\!!XTP`' ! R  R\ | P`P | P`PXt``R`pa|aa`lbbRtmpfiledl__page_sizeoff_t_sizetmpfilebionic/libc/stdio/tmpfile.cosetfpos_t_closesigfillset__sbuf_readFILEfloatunsigned char_seeklong unsigned intsigset_tshort unsigned int_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int__kernel_mode_t_offsetlong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write_cookieshort int_flags_extsverrnolong int_file__kernel_off_tsigned char_nbufmode_t_lbfsize__page_shiftGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.tmpfile.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^^pZ  np+j p z2  x p0 0 , 0 @ p\  H p   p)   pI ( 0 p0q  01 oC S &@!      " ' ,4=DPX_els{bionic/libc/stdio/tmpfile.c$LC1$LC0$LC2tmpfile_gp_dispmemsetsigprocmaskmkstempunlinkumaskfchmodfdopen__errnoclose !%3:AHOV]dkry([i-;& * . F] k pz      $ ,0<( Hd       , H !D P|  " # "       ! % , 0 7 ; B F U Y ` d k o ~             tmpnam.o/ 1331265332 1002 1002 100644 4496 ` ELFPP4(%"0% RU$ > $ > $ >  I: ; I.? : ;' I@: ; I 4: ; I 4: ; I I !I/ 4: ; I? < 9fintyT2wh s- )/ buf0 } 0 0 bionic/libc/stdiobionic/libc/includebionic/libc/include/systmpnam.cunistd.htypes.hstdio.h-,IKKIKK warning: tmpnam() possibly used unsafely; consider using mkstemp()%stmp.%lu.XXXXXXXXX/tmp/<'!',($!$$! $ $#b$"! ,($ 0'& | P0L | P0L0 (T(x`T`tmpnamlong long intunsigned intunsigned chartmpcountu_longbionic/libc/stdio/tmpnam.clong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3tmpnamlong intdoubleshort unsigned intsigned char__page_sizefloatshort intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.gnu.warning.tmpnam.rodata.str1.4.rel.text.tmpnam.bss.buf.2422.bss.tmpcount.2421.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 #>xLpx^p,Z # np>j x# zB2(D p#p0 #0 #p0T `#p h#p  p#(p$ #6p0A0JoZ $ (^   *38 !=DMVbionic/libc/stdio/tmpnam.ctmpcount.2421buf.2422$LC0$LC1tmpnam_gp_dispsnprintf_mktemp !%3:AHOV]dkry   ( 08 , @4 HT` d        $ + / 6 : A E    ungetc.o/ 1331265332 1002 1002 100644 6704 ` ELFP4(!??@% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .: ; ' I : ; I4: ; I.? : ;' I@: ; I : ; 1RUX Y 1 U41414: ;I? < 4: ; I? < A@csint- q]M aC-NKW ;X# YE#0Tw _px# _ryE# _wzE# }{7# |7# _bf}# ~E# k}# 4# R1#$ !Q#( Y|#, #0 _up#8 _urE#< #@ #C _lb#D E#L ;#P E } E1 } E Q } E7 Eq } q Ew W00X & 'E#` # _ub$# %#/Efp/i1Ep2REcOE!fpO`'b\Cp  EBEb bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeungetc.cposix_types.htypes.hstdio.hwcio.hfileext.hlocal.h0IKARZ<(JKIK(u>IKKGMIKHMMKMHKILD( >KIFLLQyJQ\Z>KIKKIM=I<'!'<840,($$!%!c`E[ b0F0G0yI0Z m4 0Dd12F*p@&f$qG%2<! 840,($@'a@ !(!@P@!F!(@ ! 00T@&8_0$<tBMB&$ ! <! 840,($@' !   ! @ 1T  m4  I1 +X`@&le$H$ ! $ $@0$b0C$BxAu@zT | (P@\ | (P@\ DTDaTaa @U@`U``SLTSSS%ungetcXXoff_t_sizewchar_io_datashort unsigned intfpos_t_close_offsetinc_ret__sbuf_readFILEfloatunsigned charlong unsigned intdummy__isthreaded_blksize_ubuf_wcio__sFILEbionic/libc/stdio/ungetc.cdouble__sdidinitunsigned int__submore/u/raghu/ics_feb29long long unsigned int_seekerrorlong long int_baseGNU C 4.4.3charungetc_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.ungetc.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 @>xLpx[^pZ H npfj ( ~z 0` p <  < p8  p  p(  pH P pp0 0Z ol |       #,7?LV^eqzbionic/libc/stdio/ungetc.cungetc_gp_disp__sdidinit__sinit__isthreadedflockfilereallocmemcpyfunlockfile__sflushmalloc !%,3:AOV]dkry!=KYgu'3 7 ; L Z _e jp y }  @ L P \  $   d         ! % , 0 7 ; B F M Q ` d k o v z                     $ ( , 0 4 @ D vasprintf.o/ 1331265332 1002 1002 100644 5616 ` ELF P4(!% RU$ > $ > : ; I  $ >  I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@: ; I4: ; I4: ; I 4: ; I 4: ; I : ; (9gf&int|za q4 aC9N GW "X# YE#0 Tw _px# _ryE# _wzE# p{7# |7# _bf}# ~E# ^# @"# VB#$ b#( L#, w#0 _up#8 _urE#< #@ #C _lb#D E#L N#P E"  EB E( b EH E  Eh00\ & 'E# S # _ub$# %#`Estr!fmtJap}]retEpfu"err2/ bionic/libc/stdiobionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includevasprintf.c_types.hposix_types.htypes.hstdio.hwcio.hfileext.h GKKKKKxJP=KKIKKIKRvtPK=<'!p''$B$x|T20! $$4x@|$$'8 ,$D!@$4 E$@! '4 ! @ $ $F | PL | PL PTP`` 4U 8VaRaavasprintfoff_t__builtin_va_listwchar_io_datashort unsigned intfpos_t_close__sbuf_offset_readFILEfloatunsigned charfextlong unsigned intdummy_blksize_ubuf_wcio__sFILEbionic/libc/stdio/vasprintf.cdoubleunsigned intlong long unsigned int_seeksigned char__va_listlong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tvasprintf_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.vasprintf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx"^pZ  np/3j  ~dz 8 pl0 0 p pp  p  p p00y  o    Y    )29DLQbionic/libc/stdio/vasprintf.cvasprintf_gp_dispmalloc__vfprintfreallocfree__errno !%,3:AOV]dkry~$2N\jx   + : H W ix   t           ! % , 0 7 ; J N ] a p t {         vfprintf.o/ 1331265332 1002 1002 100644 74968 ` ELF$P4(0-8p 0% RU$ > : ; I$ > : ;I  $ >  I  : ;  : ; I8 : ; I8 ' II&II!I/ & : ; I 8  : ; : ;I.: ;' I : ;I4: ;I.: ;' I : ;I4: ;I!I/.: ;' I@: ;I4: ;I !4: ;I".: ;' @#: ;I$4: ;I % : ;& : ;' ( U).: ; ' I *: ; I+4: ; I,.1@-1.41 /4: ; I0.? : ; ' I@1: ; I2: ; I34: ; I44: ; I 54: ; I64: ; I 7 : ; 8( 9 : ;:1RUX Y;1<41=1X Y>41? U@.? : ;' I@A4: ;I? < int;RwC)Z8|,rq;8q Cv;(RfN WC hXC# &Y)# U DTwk _pxC# _ry)# _wz)# p{\# |\# _bf}# g~)# # 0{# #$ I#( #, #0 _upC#8 _ur)#< O#@ 3#C _lb#D i)#L m#P ){ k ))  )  ))  UU 9I  &2  ')#  #[ _ub $# c %# _ & ' '# | (0#   * A +# > ,)# : -)# [U  q&  x# y #| z # {#Ddi&)yuuD$)u$u&DcvtCu)D) Cch)"C)P)fbprve )')p0exp))pt03)((( 7CTC}) D!newC C"h h#aphh?i!fmtk!chl)!nm),!n2m)`!cpnpDo)pCC$q7r)ps) Jt) !wcuB psv%I&L& 'D)(D)   0)1?)*fp?*uio?+errA)   ,`4 -T -g .R)S)p*fpS*fmtS*apS+retU)/V /_W2+bufXpU0))( *1fp 2i1ap3fmt3ch)3n)+m)3n2)3cp45"E5D)p"6ret)4)5)#5&3wcB'+ps/5{(45)(4n)4)4I*p5v+7( 8OCT8DEC8HEX5 .5)8/4U)5)15946uioʋp6iov:q6bufJt6ox[p5ΚL447kq5054J)/4ً44ې%3,%1(&Lz& %\p% 9hex &I:8 ;;(8<:X ;;(<:0$ ;;(<=\?7 ;9;.;$ \5.p<>+K5>65' 2 ph:\ ;;(0<:H ;;(p<: ;;(<: ;;(<:;;(<:(.;;(@<= \;;  <=4L);; 4L<:X;;(p<?D):I!;r-f6;[(>~7>X7.q H((D):[J[[k{{{@) :1fp*:2S:1apq:6ret)RAR)t bionic/libc/stdio/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysvfprintf.cstddef.h_types.hstdint.hposix_types.htypes.hstdarg.hstdio.hwcio.hfileext.hfvwrite.hieee.h (LFM(=MxHLn(N;<%\JH 2J<DJ;JN!^JI J "J]E HH.J}JJ(JJ_0~4xJeJsJK ~tK%tt J J JcJJJP J J J E4KIKKK{o tJJJ!(#J(J#(Jr")0+J0J+0JP!(#J(J#(JDK";4)0+J0J+0JJJJ! #")+Pttt*t61J6J16J*1iJJJJJJ+htEtKJ<#jttr?yQ~HIM <~JJ~JJBHH~MKK~JvJJ xE,JPJJIJKJHJ\JJ(JmJUJkJwJKL}JJzJJJz(JzJJ40NzJzJJz(JzJJ,,J<zJJJz(JzJJ,v|<qHJlIIKKCn~JJ~KKIK~,K |J<zJzJJz(JzJJz0uKJzKJ@K{JBLHKK,4z=J?JJJHL0v8<4zJJz(KJ#KKHKK0u4Mo<,IK4@u (zNKIKKILw<7PIKK:@u{=J,<zJJz(,0E 88zJJz(=J~GP{=J~{uKJ zKJ|M(y$| ,~ 9y  ~0(~ ~  u<}88zJJz(   u    D   M  <r$K|$z=JzuKJ/yvHG~Jq~$K = $K0}H~J~8_<yJyJy~Jz<AMM,JJzIKIK~~u$<|$LyJy~J ~J<yu=z3<x}8 <'!'40,($$!!'C@$$! !(@$ %! @ !@$ 3! f!( #0F4!0,($8'$!(@! $$ !(`" ! @3<'!'lhd`\XTPLH('88$! '$'x|$! (`d'$!%$04B@8S!R&B@*`& x C%$$q!0Ő,!ώ!p1&B$*c$8| elhd`\XTPLHp'?&$1&R&Bl$h$$R&D$[,`@*!Xj!H\ 622$*" *p!x$ &62`2$*) *p!x$ &62@2$* 4$ 0$*0 *!$ w&$*@ *X!( $ k& 22$*_ *!@T $  \& 6B$*x *8!$ M&2$$*@; *(!X $ l>&BGz6BFu@6B*$WR& BBR&I$ %-D$j[,6dBD$!(h@`B!X!(D$ ,@R&$$XDD$!SB6PBD$ M,!@!&@x!!$ N,&&$$$$* *! B0&.B6+B2$2 2$*y *(!P $ K&D2$*! *@!Ht $ *&$2$ 2@2$*Xl` *! $ 䢷&*8 4& 0^@2$*XE` *! $ b&* *0!p $ ġ&8 2$*`S *!$ f&4% 0R& 6B4Y% 0R&6B4$ 04' 0*@ *h!pá &n2$* 4$ 0S2$*  *!8$ @&*@ 4Y$ 0h2$* 4 *!0 $ Π(&<40D$ @<@%D|($! ů$ $x4Y% 04' 04Y$ 0_]2$*H  *(!` $ &g @2$*P]@ *(!h$ &O$@2}$$*Y@ *!$ &"@2$* *!@ $  &!$$D$$*V@ @40D$ <<@HD'@$$*X|` *!T$ d&S`2$*h@ *x!$ Ģ&*h 4% 01`$$*0 4% 0& 0B4& 0$l!49% 04% 0*0  *H!P $ KR&* 4% 0 $$*D *H!P $ K:&*`3 *!$ f/&4% 04% 0D$ ,a!@!&X@P!HK!$D$ ,&&U$$4y% 04' 0?4& 04% 0ppppX ``LP```0$LPP<'!'@! '  '0123456789ABCDEFInfNaN0123456789abcdef(null)0.<'!' !C0`F0 $'$4`hd'xt"@%$*^! %$ Cs&b@#q$dh$!(hd'x!`!x$>x'4'1&(8'7$hl|!$$*$$l $p+ $ $1&&[,& $ (!hl!@p 'h2!h/h2/h|#+`b*{@`'$&s&d*dh,%$)h`dds&d*d!dh%!E)h2d(&@2 $ dhX$d%('+hd&$|l#)`h*(`'$~%&s&d*dh"%$L(hds&d*d!dh%!nE)hcd&2`f*ldh%! )hd&25h|h#/`x* `'$tB$s&c*`Vdh%$+Thd s&c*d`!Sdh,%!g)^h dty& `'&@ hh|x*(  h!P`xpd !  $!o!p$!` !624 2j 24@ ! RO&$$0Ҍӌ$%p$%r($$h'`h$ll!*( (php@hh%h62`4 224@!XҏC&$$`s$%p!%r(62^4 2624@X !K2G&$$R~$I$p@S$%rȇq З͗̏,ˏ2h' $l''lp !  @x ! x$ Bx@2` ֗@6 էx' ! N@ . —;`!Xd@ !(RX&$$pҍ%%pAӍ#@ !(RM&$$ $$p!%rI(@!XҏS&$$`eg$%p$%r6(t `' h@d!!(!P4!x_!h$|R&# |677h1&& , !p@h7!P!D& ,1&+d* D!@`((76767&!7@!xx!& , 1&4|$0g$rG$q$2 4@` !XLrC&$$g'$P 76;72'f4@!hRL& $$x'%p2%r$(@67674@` !XLrH$$ (R&!hl!@p '7X64@H!IrC$D$ >R&! `!0 !( @#pC*h @l!8( 8(h!!@p672$ 224@N&!(CN&$$H$$%2p367##+ #D- $($%r~$d!|h#`*`'$%&s&j*@dh$$')hds&j*d@!dh$!)h~d&t  hd^@!R!dt  hdK@!$R_ $?Kh@/ i2%c$0"%%8rb2@0$h#ClO!`!  !( h @d!$0$ $,- dh%e&,'( h~ dt% `'  @p!t `' h@dtp ! 4x' 8 ȗx@1$ xx'VDD2 FE0$dh_$+%$+ he`d&0*(N$2gCdh'%'*FhT`dB$s%V`l* $>%`'B$s&m*Wdh%$E)^hd!dt  hd@!)h`2e. $$,-dhI$%,'')h{d&DD2 FEc$'Wdh$!)ChPdB$Edh%!8ND'+Ih-dB$dh$!@(hd& $0 dhK$,%$)hJd&0# hd#x %!s!()h`dt& `'!@ ! $ dh'$W(h"dty$ `' @ !`!dd2O!`9%'c$%rkh#(Cl!Ƞ@h l.0x&l! `!(@ $ !8 0H$'! `!(@ȣ $ !8 !``!@ C,`l0x&أ'h#xl!t !( h@d!j@*@Epdh?%!X+hd&0#N'`e*$&`'B$s&x*Wdh%$(^hd!d%Sdh%!s+^hdB$2-$Pdhi$$%')NhUdB$t& `' m@(!s%`l*\$$`'B$s&e*UWdh%%I)^h d!dt !( hF@d!4`6$P(t `' h@d5tDhc$dh#hClH!Ƞt `' hd!@!!t `' hd@t!$ !'Sdh'!)^hdt& `' @}!$!ty$ `' @K!422@24@x!hOS'X&p!!!`(42`24@8!`GC&3%Sp!@P!(JR&$$hX%%$Sdh$!*^htd>B$42r`2q@24@H!IrSJ$J&p!$!`(^42`24@!_SK&L$×Ap#~7't& `'`@ !$ @h$dh%h%'^(hmd&$Wdh$ &%(Nh dB$0#`f*$%`'B$s&g*Wdh%e%+^hdX!d@!PRRSM&%×qApp#@ !_S$@!R2^&'Sp!@!HR2SB%#&t% `' @!!@$ty$ `' @!t !( h@d$!t !( hd@!htd! & `'@ d DD< F?E$hl(!@p'$! `  l!8@1& 67 h !pҍDq&|!hR&w~# tY$ `' |@!^dh$!o(ChHdB$$-$(hl-$!@p$t' `'\@ !#0ls!'Sdh%!pI)^h dB$ @p !0NҌS'k(l* hpV!@ FE5$8eX $(hl!@pF%@!(CS$2@f$@0F(*@g:e$E$ ! B$0@D+ $E N(0F$ 'ff 24@ !pRҍS%$ x $Et00ll2 D%!l2l#('N`4@X !K2SB&'×EApD#-$E#4@ !_S$P 4@!(CI&D%Sp!4o7}`4@!HR2SB%@p !0NҌB&%Sp!@!0CҌSE&%×Ap#$$ ,X@!0! !s&p@@f!!%$ ,s&s&N4!rE&R&( (G!@!%l#lp% 44  hlp4Y$  7R! !YF'4 !xEdR&q&! @hlpy$ 44 Ep       8     < < h  x |  $<'!',($@! ! ` ! ,($0' 0000000000000000 |  (P8T0 Pph  `P H0(Ph  P0L |  (P8T08 Pph  l`P H0(Ph  P0L(8 XTXaT(a DUD`(`<|c c<b(b (c  \T UdadpUpxax a V$$pp  W@@p p T`bpb8bd bRR$@R@pR RLTRlR(R0RRRDRLPRX`RRR0RHRRDR\RRR@TR\RR(TRdtR|RRR R 8 R` R  R$ 4 R\ | R R R R  R L RX l Rt R R  RP ` Rh x R R R@R@RULUfPfff <fLff$4f`ffff8f@\ff(|ffH f` ` f f\ f  f t f P fg$Lgp g$Dg`dgggg0tggggDxgdg|g g@ g \ gh g gL P gt g  g ge$Te$eLdeleeDde|eee e ( e@ e$ e e, e ep   h$  ,$,LLl$l$$$$$@$@`f`|$|$$00H$Hhh$$$$$$DD\$\||^$Y$Rf$((@$@\\t$t$$h((d$dtYt||WS$$  @ $@ ` ` x $x  $   $ $ $ < $< \ \ h $h  $  S  _  $ X    \  , $, L L X $X t t $ g $  V  \   P $P ` Z` h h x Wx  ]  g,`@h`p `XdpXdd dR$@R@pRR(TR R` HT (U(0`0<U<X`( TTTn(`n`hnnd`(,`,n``n(`n$$n$%n TUT$$\\$$$$( TVT4b4<<PbPb88b$$\\bbb,b,PPxbx` b` x x b  b  b  bbbddhbhbb44\b\bLbLTTlblb((hbh||bbb4b4<<HbHPPlblllbb8"b8"@"@"t"bt"""#b####b###|$b|$$$$b$$$$b$$$$b$$$|%b|%%%&b& & &8&b8&@&@&&b&&&&b&&&'b'''T(bT(`(`((b((|acacaPaPca$a$d'a'(ag|ggLhgggg  g t g g g | g g  g 4 g8 | g g g g l g| g$ggdgg(g8g|gPgggtggggglgtg|ggdglg(gxgg g!"g""g#H#g#$g%&g$&&gP'\'g''g4(8(g@(H(gt(|(gHgxlchccdcccggg8 p c c clcccdcU(DcDgcU`cccc`cDcccg cltgcc8c(c(`gTc c""c$%g &$&c0'P'U'4(cd(t(UxZdZdZZZZ0Z<ZZ8ZPZH Z\ Z Z ZtZ ZLZXZZTZdpZZZD`Z`ZZ<ZZZZZZXZ4Z\ZZtZ`ZhZZ Z(ZZZTZdlZZ(PZ`ZZxZZ D Z` l Z Z!!Z""Z "d"Z""Z""Z##Z##Z0$$ZL%%Z%%Z &D&ZT&&Z&&Z&,'g<'H'gd''Z' (Z8(@(gH(t(g|((gS(dSxcS@SLSScSc c S  c` h S S SSSpSSSDcSSxStSSSSXSlnSSDPSS4DS\SSHShxSSSdlSlxSSSS(PSP`cnSSc$S@xSxVS SD ` S ^ S !S""S""S(#@#_@#\#Sl##S#0$S%L%S%%S&$'c('P'cP'd'Sd''c8(@(c@(H(SH(t(ct(|(S|((cte`Re`e`e`ed`dpRpe(`(e``RX`XR`e`e`ReT`TDRDH`HeRe4`4\e\`e`e<R<@`@tet`R`e`Rd`dlRl`Re R (e(`R@e@xRx`Re` R "`""R"#e#H#`H#L#RL#l#el#$`$%e%(`\ffffdfpf4f\ffhft f $f%(fXXnXXXXXnXX X n n 4 Xh X XXXdXXn(,nD`X`dX0XXXXXXXX XDXXXDX\XXX<TXhXXXXXlXX(PX`XXXxXX D XD l nl X X h!n!!n""X""X""n##X##n#<#Xl##n##X# $n0$$X%%n%8%XL%%X%%n%&X 'P'XP'd'nd'h'X''X4(@(XH(t(Xt(|(n|((Xxpx(p(pt pt g ( p (  p ( p(|p||gp($p$(p$R(hRRRRD`R`RRhtR(PRccc ccc(ccD D cd l c !c""cl##c#0$c%L%c%%cP'd'c@(H(ct(|(cp0p0p p 0 p0p0pXZXp0p0p0hphZpZDpD0p0p0 p <0<tpt0@p@X_XpZp_D pD ` 0` !p!!0!#p##0#$$p$$0$00$$p$8%p8%L%0L%%p%%0%@(p@(H(0H((pTlcblSbWb0cb08SbcbSbcb0HcbHPSb|cbSb` x cb cb SbcbcbcbSb<cb<HWbSb<cb<HobXpSbpcbcSRbcbcb4SbcbLTcb(cbh|cbcb4<cbllcb8"@"cbt""cb##cb$$cb|%%cb& &cb&&cb&&cbhR,8RRDPRRh x R RR8RRR,4RR(RllRLXXXXXXXXX X\ h XXXXXD`X`dX0XXXXXX XDXXX4DXXX<TXhXXXdlX(PXXXXX ` X X""X<#H#Xo(oh^ho^o`^`o^o^oooo, t ot R o ^p^^o^dp^ooD`o`xoo ^^to8o8^oo^o8o8\^Ddoo4Doo^Tohto^o^dl^lp^^(Poo  oD ` o o !R!!^""o""^""ol#x#R##R#$o($0$o%%o%%R%8%oP'\'o\'\'Rt(|(oLUxpx4p$p$&p&$&o$&'p''4''p''o'4(44((p((4((pXp VV` l V##V$ P TP d R T R""T""R""T#0$Tt(|(RpH pH  D pD ` ` p !!"p"""l#pl###$p$%p%L%L%%p%%%P'pP'd'd'@(p@(H(H((p !!R!!o##R%%R@(H(o RD H R!!R##R8%L%R@(H(RT(TpUpTlUlTUTUTTU UUU TXUUdhUTUUDHTTUTTTTUTTTLTTT4<TTUDThtTtUUTUdlUTU(DTU  TD ` U0!Lp^^pVZ  . npQxj (. ~)(z (@. *  h.7 .t9` .29@:( 8. bl . \d 0./dCd[p eW (P.leh x(. zpf:v N."pK. .$py@ 0.&p .(p0ɥU0o0@/* ;   ( 0 A`JV "$&(*bgl0q8v<{+,(%1bionic/libc/stdio/vfprintf.c__grow_type_table__find_arguments__sprintblanks.2781zeroes.2782$LC3$LC0$LC4$LC5$LC6$LC1$LC2_gp_dispmmapmemmovemunmapmemsetmemcpy__sfvwrite__umoddi3__udivdi3__vfprintf__swsetupfree__sflush__dtoamemchrstrlen__errnovfprintf__isthreadedfunlockfileflockfile  @`3; !%1>CQX_fmr'5J}%3O] $3M\hvEQcz Js     "/7 ; ?HSbgrw "-<LS X`h l uOZ   ( 2 7 A U d n s }             ) 3 8 B G V ` e o              $ + 0 8 @ G L S _ d p t            < @ V f j {            7 ; Q a e {            #37MQae{  #X**D +p , - . + /**H x  4 -l x <    (  t     D      @ H     , +  h X  p   h p        <  X `  t   8 T  ( l          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                     **< 0**\ 4l < 0 < 04 0x 8  5  3$ 6 4 0 7< L   ! ! 8$ , @ 0  04 5T - ""0 #<#l t$ #0#  p 1 2 0l t  #$#D X  04 0 0 0 < Hx     "" ##D Ll x  0 0< D| $$ 9 $ $$  | % %! !" "" "" "$# %D#%H# P#$ :h' ' ' ( ( (         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                            $ ( , 0 4 8 < @ D H L P T X \ ` d h ** <0 3H =p > 8< lp < p     $ + / 6 : A E T X _ c j n }                      ! % , 0 ? C J N W [ c g p t |                         # * . 5 9 @ D K O V Z a e l p w {                               ' + 2 6 = A H L S W ^ b i m t x                               , 0 7 ; B F M Q ` d k o v z                               & * 1 5 < @ G K R V ] a p t {                               $ + / 6 : A E L P W [ b f m q                               % ) 0 4 C G O S \ ` p t |                           ! ) - 6 : B F O S [ _ h l t x                              "  &  -  1  :  >  F  J  Q  U  ^  b  i  m  u  y                                "  &  -  1  :  >  E  I  R  V  ^  b  k  o  w  {                                 &  *  3  7  >  B  K  O  V  Z  c  g  o  s  z  ~                                 $  (  1  5  =  A  H  L  U  Y  `  d  m  q  x  |                              !  %  4 8 @ D T X g k r v }                       #*.59@DKOVZimtx&*15=AHLTXaemqz~&*26=AIMTX`dkow{ #'/3:>FJQU]ahltx   $,07;CGNRZ^eiqu| "*.59AELPX\cgosz~%)04;?FJQU\`gkrv} "&-18<CGNRY]dhosz~  #*.59@DKOVZaelpw{$(/3:>EIPT[_fjqu| !%,07;BFMQX\cgnry} &*15<@GKRV]ahlsw~ #'.29=DHOSZ^eipt{  $+/6:AELPW[bfmqx|%)04;?FJQU\`gkrv} "&-18<CGNRY]dhosz~  #*.59@DKOVZaelpw{  '+26EIPT[_fjqu|      ! % , 0 7 ; B F M Q X \ c g n r y }                        !! !!!!"!)!-!4!8!?!C!J!N!U!Y!`!d!k!o!v!z!!!!!!!!!!!!!!!!!!!!!!!!!" """""&"*"1"5"<"@"G"K"R"V"]"a"p"t"{""""""""""""""""""""""""# ####!#(#,#3#7#>#B#I#M#T#X#_#c#j#n#u#y#########################$$$$$$%$)$0$4$;$?$F$J$Q$U$\$`$g$k$r$v$}$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%"%&%-%1%8%<%C%G%N%R%Y%]%d%h%o%s%z%~%%%%%%%%%%%%%%%%%%%%%%%%& & &&&&#&*&.&5&9&@&D&K&O&V&Z&a&e&l&p&w&{&&&&&&&&&&&&&&&&&&&&&''''' ')'-'5'9'B'F'N'R'['_'f'j's'w'''''''''''''''''''''''(((("(&(-(1(8(<(C(G(N(R(Y(](d(h(o(s(z(~(((((((((((((((((((((() ) )))")&)/)3)<)@)H)L)U)Y)a)e)n)r)z)~)))))))))))))))))))))** ****&***3*7*?*C*L*P*X*\*e*i*q*u*~**********************+++++!+*+.+6+:+C+G+P+T+\+`+i+m+u+y+++++++++++++++++,,,,#,',3,7,C,G,S,W,c,g,s,w,,,,,,,,,,,,,,,,,----#-'-3-7-C-G-S-W-c-g-s-w-----------------....#.'.3.7.C.G.S.W.c.g.s.w.......................//////%/)/8/1E1I1P1T1[1_1f1j1q1u1|11111111111111111111111122 2222!2%2,20272;2B2F2M2Q2X2\2c2g2n2r2y2}22222222222222222222222233 3333"3)3-34383?3C3J3N3U3Y3`3d3k3o3v3z33333333333333333333333334 44444&4*494=4L4P4Y4]4e4i4r4v4444444444444444444445555"5&5-51585<5K5O5V5Z5a5e5l5p5w5{55555555555555555555566666"6+6/686<6E6I6R6V6_6c6l6p6y6}6666666666666666666667777$7(7/737:7>7E7I7X7\7c7g7n7r7y7}77777777777777777777777788 8888"8)8-84888?8C8J8N8U8Y8`8d8k8o8v8z88888888888888888888888889 99999&9*91959<9@9G9K9R9V9]9a9h9l9s9w9~999999999999999999999999 ::::*:.:5:9:@:D:S:W:^:b:q:u:|::  (0     $(,8<@DHLX\`dhlpt  $048<HLPTX\hlptx|  $048<HLPTX\`dptx|(,04@DHLX\`dptx|    vfscanf.o/ 1331265332 1002 1002 100644 25064 ` ELF7P4($!x% RU$ > : ; I$ >   $ >  I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ; ' I : ; I.: ;' I : ;I4: ;I : ;.? : ;' I@: ; I: ; I4: ; I4: ; I4: ; I4: ; I 4: ; I  : ;  : ; ! : ;" : ;#1X Y $1% U&4: ;I' (1RUX Y) U*41+ 1,!I/-4: ; I? < .4: ;I? < HD%int;i:[w8p(q8eu  wCN W X# Y)#I Tw> _px# _ry)# _wz)# {P# |P# _bf}# ?~)# # N# n#$ #( U#, #0 _up#8 _ur)#< #@ >#C _lb#D )#L #P )N > )n )T  )t )  )II\)c)TWtabfmtc)n)v))sc)),fpe! e`ape~fmtgch)4i08pj$nk)v8l).p0mn)o)p) qybufr{uM  q!!("ok$\ "fok#x$%&sum^0 %&res? %@&res ' :&rr0 ( X$$$)*07 *: *D +N`,P-8-9P-&:.d) bionic/libc/stdiobionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysvfscanf.cctype.hstdio.hstddef.h_types.hstdint.hposix_types.htypes.h<oJJoJJJPJ}JKtu:z  L{4n,JxJwJJJJJnJIKI JIKIKXJ1[ x|~EN7JIJKJtzJKJIK(}~JKKIuD4cJ=KI4p4=z7JIKIKJstIM!L JJJi1K=IK}wEP^IKKKqIKKKG|J|JLI QL+IK*IKKWKZK)m$FNI'KIK ~ T JLR JKKML|JKIm,MG} J}}JdJK|tJ~ JsJ~IKHKKN~KpJKK|JKIK_{KIK| ~|vnJ|MG_<'!'tplhd`\XTP!!|@!<<< !!B5@!(@d!@0R&@m!XjI1 $$1&@L ! @LB%$N!0@CeF$!`2`!@t!`plhd`\XTPx'$1&B$l$h $d $i $o $u $x${O,R& !(@!x3: $4 $$'!8!!  !@t!`plhd`\XTPx' <4 $4 $70$(,Mn!`j1@( &%B$1&L ! 2@L1&,$$(+`$$$$$0 8!(#8*g !0#LHD ! HL!(@D !9BH ! ]@H$_ sk$$$ $%,/' H,6%@$%%!/7o6$$O$1;-%@1$(%e$c$d E $ c$L@ !(Ld@L@ !(@L 1f@$#+!q %!h!X` <@5$Xv$@ P5b"'c$@$$@1$@1$@ 1$@` ! t$$X% /'  P6 %@$!8c$ $ $$/6L$1N-1@1 x$X$ 1" $ 1@$ D@ !(D@ 111@1 1`1 1c1s&&$#"|!x %!!p<0o 8!0'O!B$d$$`!0`$0! 8B!0Xi!@81B$$$9!0LH< ! LH@<$l s&!8$Oh!0c@ % jb%[$LH<D ! LH<J@D$LH<D ! LH<@D!0!8$'N!h3 I% 'h+g `c$LH<D ! LH<@Dc$LH<D ! LH<@D`!0`@p '!` m)$@ %$@$c$`@1@ '!Xk`$`5 $$`<.7$@1$@ 5 1 1! $ O!`?< 7$@  $ o)@1`$L@ !(@ 1L1 F&s&!0$ !8C@!Q&ps& $ $$ 4 $4B$ $4 $H^ $ R&!H'v >!'GB$D- $R&4$BL$KJIH$%04!(BM4 $ ^$4wB $4 $@4oB4lB$@8!x%!$cBBN^40 `00&Ѡ $4 $~$4KB$D@ !(@PDĒ!( LL$+v$!`LH<D@840 ! LH<D@84@0$@1$#&!s&c$#0f&`s&!&LH<D@84 ! LH<D@8@4@1%0#8!s&&"b$ D@ !(@Ds&&#0!&B!0!&$#HI]$! BJG2@R&!@@s&& #Xg!P!( l!R&4BR&4$D9*7!R&%*xIB$BR&4BH $R&0&I$#0FE!&$#8A!y$m s @0 0 @0`0w-&&)QR&-$ ! U${s&&$+F@ !(A!`    X l l L T   l l l t  4 X    44    8 8                 | 0,Ph   | 0,Ph  , TTTd`dlTl8`@,` pU@LU TVTTdTlVl(d@dL\bl0b@ blUU UTUUUU<`TlTH\UdxUTpTUULTU`tU U  UD | U  U @ UX U T U TUU4UUlWV(8S8lW S 4W8\WYiY,UHUH\WlpSp|h|SxUSWVSW0V0LUW$,UX`U`lW S0 0 S0 @ U W S Sp | U V,0V0@W@LSWP\W`dWdlV SlWV(8S8lW STSlxSHSH\W WpWVdV8 0 W0 < S W S f S W8 < V< P UP T VT X VX x S W WdlWt|S Wl|S|V(lV V4TSxSSHLSL\VX p V W0@VDLVST\VdlWlV (V(8X8pVV XTV4V8PVVVXXp|XXHXH\VdVX(XVVLXVV`dV8 @ XT X V L VX V X X Xp X V X,XLVXLV|V Xl,c,8R8Xclc R ,cTcRxcxRtct|R|,ch`al4aTaxaxxa a @ aD a8da,al[[[ [[H\[[p[8 [  [ 0 [ [ [ [ [lpU,lU U,XUxWUURSl !  !T !4 !8h ! !` !p !\ !d !p` ! !$< !` !  !8 H  !p  !  !  !   !8  !  !  !$ !L !| !  !lpRR RlX(lX XhX$XXH\XdXXL`XX`X X L XP p X,XX$4XXlT8lThTT4T8`TTHTTdT(TLXTT T@ L T TX\T`TTTTlYYY YhY4Y8LYYYH\YdtYYL`YY`Y Y Y L Y8 p Y,TYY,4Ysvfscanf,4p 0 , @ $4L @ $4L,size_tbasefixuint64_tnreadnassignedlong long unsigned int_lbfsizeGNU C 4.4.3__sccllong long intsigned charuintmax_t_ubuf_base_cookielong int_flags__builtin_va_list__va_list_blksizedouble_offsetoff_tvfscanf_readfpos_tunsigned int_closelong unsigned intisupper_file_toupper_tab_widthshort unsigned intliteral_writeisspace__isthreadedagain__uint64_tfloatbasematch_failureunsigned charshort int__sbuf_tolower_tab___sFILEFILE_seekchar_size_ext_ctype_doswitchinput_failure__kernel_off_tccltabfmt0/u/raghu/ics_feb29flags_nbufbionic/libc/stdio/vfscanf.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.vfscanf.rel.rodata.vfscanf.rodata.basefix.2464.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 @">xLpxM^pZ @H" npj PC" ~,z XC@"  D "#$p8#D L"|#D L"p# L"p2 `"p2  `"p2  `P"p03`'0$60o66F6@(=@# h?   " *, 2;HPZfpw~bionic/libc/stdio/vfscanf.cbasefix.2464vfscanf_gp_disp__isthreaded_ctype___srefillfunlockfileflockfileungetcstrtodstrtoumaxfreadstrtoimax !%1>ELSZafszP^z"0OYu   %*49CHfr w}        # 5? CU^gpy  < x       @ p  D H p    P   !   @   8 @   "    p  #        $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                            ! % , 0 7 ; B F M Q ` d k o ~                           ! ( , 3 7 > B I M T X _ c j n u y                               % ) 8 < C G N R Y ] d h o s z ~                              # * . 5 9 @ D K O V Z a e l p w {                             $ ( / 3 : > E I P T [ _ f j q u |                              ! % , 0 7 ; B F M Q X \ c g v z                               . 2 9 = D H O S Z ^ e i p t {                               $ + / 6 : A E L P W [ b f m q x |                             % ) 0 4 ; ? F J Q U \ ` g k r v }                                '  +  2  6  =  A  H  L  S  W  ^  b  i  m  t  x                             $  2  6  D  H  V  Z  h  l  z  ~                      .  2  @  D  R  V  d  h  v  z                        $  (  7  ;  B  F  M  Q  X  \  c  g  n  r  y  }                                   &  *  1  5  <  @  G  K  R  V  ]  a  h  l  s  w  ~                              $ + / 6 : A E L P W [ b f m q x |                           $ ( , 0 4 @ D H L X \ ` d h l p t x |                 vprintf.o/ 1331265332 1002 1002 100644 4680 ` ELF, P4(!t% RU$ > $ > : ; I  $ >  I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@ : ; I!4: ; I? < uLAlintWZFq  f aCN ,W X# YE#0 Tw _px# _ryE# _wzE# K{7# `|7# _bf}# ~E# 1# %"# ;B#$ b#( %#, R#0 _up#8 _urE#< #@ #C _lb#D E#L 3#P E"  EB E( b EH E  Eh00A9E(fmt%ap%}, bionic/libc/stdiobionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includevprintf.c_types.hposix_types.htypes.hstdio.h&<'!!!0T$ !(@ |  ( |  ( T(R U (Vvprintf((off_t_size__builtin_va_listfpos_t_close__sbuf_offset_readFILEfloatunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoublebionic/libc/stdio/vprintf.cunsigned intlong long unsigned int_seek__va_listlong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write__sF_cookievprintfshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.vprintf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^piZ (x np{j  ~p(z   p    p< @p p2  (pR 8p0b0oT  <   ( %.3bionic/libc/stdio/vprintf.cvprintf_gp_disp__sFvfprintf !%,3:AOV]dkry~$2N\jx               " ) -    vsnprintf.o/ 1331265332 1002 1002 100644 5480 ` ELF P4(!% RU$ > $ > : ; I  $ >  I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@: ; I4: ; I4: ; I 4: ; I ->xk7intrq 9L aCJN XW 'X# YE#0 Tw _px# _ryE# _wzE# u{7# |7# _bf}# ~E# c# Q-# gM#$ m#( Q#, |#0 _up#8 _urE#< #@ #C _lb#D E#L _#P E-  EM E3 m ES E  Es00m )& 'E# X #  _ub$# %#Estr(!n(?fmt(hap(}ret*E+f,- bionic/libc/stdiobionic/libc/arch-mips/include/machine/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includevsnprintf.c_types.hstddef.hposix_types.htypes.hstdio.hwcio.hfileext.h.tQFKIKKKIKKs<'!x''X ' $$648<(0('!( !0(`'<4$ | PD | PD `TT TUUU dVV lWW vsnprintfoff_tsize_t__builtin_va_listvsnprintfwchar_io_datashort unsigned intfpos_t_close__sbuf_offset_readFILEfloatunsigned charfextlong unsigned intdummy_blksize_ubuf_wcio__sFILEdoublebionic/libc/stdio/vsnprintf.cunsigned intlong long unsigned int_seek__va_listlong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.vsnprintf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p|Z  npj X ~z ` ph( x( p p\  @p|  Hp Xp00l  o~    P=    )2bionic/libc/stdio/vsnprintf.cvsnprintf_gp_disp__vfprintf !%,3:AOV]dkry~/=Ygu  # 2 ? N \ l 8        ! % , 0 ? C J N U Y h l s w        vsprintf.o/ 1331265332 1002 1002 100644 5032 ` ELFd P4(!% RU$ > $ > : ; I  $ >  I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@: ; I4: ; I4: ; I 4: ; I m,YCinto~q#'~ aCVN dW X# YE#0 Tw _px# _ryE# _wzE# c{7# x|7# _bf}# ~E# Q# ]"# sB#$ b#( ?#, j#0 _up#8 _urE#< #@ #C _lb#D E#L k#P E"  EB E( b EH E  Eh00y 5& 'E# F # _ub$# %#Epstr-!fmt-4ap-}Gret/Ef01 bionic/libc/stdiobionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includevsprintf.c_types.hposix_types.htypes.hstdio.hwcio.hfileext.h2x~OFKHKKKKE <'!'| xLpx^p|qZ P npj  ~pz  px( ( (pZ 0Pp" pA  pa p0q0( o: J    ;   p '0bionic/libc/stdio/vsprintf.cvsprintf_gp_disp__vfprintf !%,3:AOV]dkry~$2N\jx   ' 6 D a $        ! % 4 8 G K    vscanf.o/ 1331265332 1002 1002 100644 4668 ` ELF P4(!t% RU$ > $ > : ; I  $ >  I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ;' I@ : ; I!4: ; I? < lg8intNuaq  ] aC9N GW X# YE#0 Tw _px# _ryE# _wzE# B{7# W|7# _bf}# ~E# 0# @"# VB#$ b#( $#, I#0 _up#8 _urE#< #@ x#C _lb#D E#L N#P E"  EB E( b EH E  Eh00\~E$fmt%ap%}+ bionic/libc/stdiobionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includevscanf.c_types.hposix_types.htypes.hstdio.h'<'!!!0 !(@ |  $ |  $ T$R U$Vvscanf$$off_t_size__builtin_va_listbionic/libc/stdio/vscanf.cfpos_t_close__sbuf_offset_readFILEfloatunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoubleunsigned intlong long unsigned int_seek__va_listlong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write__sF_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbufvscanf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.vscanf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^piZ x np{j  ~l$z   p    p< @p  p)  pI ,p0Y0o H  9   $ #,4bionic/libc/stdio/vscanf.cvscanf_gp_dispvfscanf__sF !%,3:AOV]dkry~$2N\jx               " ) -    vsscanf.o/ 1331265332 1002 1002 100644 5500 ` ELF\ P4("% RU$ > $ > : ; I  $ >  I  : ;  : ; I8 : ; I8 ' I I&II!I/ .: ; ' I@ : ; I : ; I .? : ;' I@: ; I4: ; I 4: ; I i&gS&intzaq! aC9N GW X# YE#0 Tw _px# _ryE# _wzE# ]{7# |7# _bf}# ~E# K# @"# VB#$ b#( 9#, d#0 _up#8 _urE#< #@ #C _lb#D E#L N#P E"  EB E( b EH E  Eh00\ & 'E# @ # _ub$# %#(EE(Tbuf(Ulen(EV Estr.!fmt.4ap.}Gf0u1( bionic/libc/stdiobionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includevsscanf.c_types.hposix_types.htypes.hstdio.hwcio.hfileext.h(2tMHIKKMHLHLHLG !<'!x''$T04$x| x$|H$'8( h' |  PD |  $PD HT 8U <VEvsscanf$off_t__builtin_va_listwchar_io_datashort unsigned intfpos_t_close__sbuf_offset_readFILEfloatunsigned charfextlong unsigned intcookiedummy_blksize_ubuf_wcio__sFILEdoublevsscanfunsigned intlong long unsigned inteofread_seek__va_listlong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write__sfileext_cookieshort int_flags_extbionic/libc/stdio/vsscanf.clong int_file__kernel_off_tsigned char_nbuf_size_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.eofread.rel.text.vsscanf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5  >Lp,^pZ  npm,j | z 0 p(8  `8  pZ P p < p( D p8 \ p0P 0 o& 6 %! \E    %-6=bionic/libc/stdio/vsscanf.ceofreadvsscanf_gp_dispstrlenvfscanf  !%,3:AOV]dkry~$2N\jx  GS W [jy   T P X   $ (  (     ! % 4 8 G K       wbuf.o/ 1331265332 1002 1002 100644 5164 ` ELFl P4(!(% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ;' I@: ; I4: ; I QMmint3[GB aCN5W X# YE#0Tw _px# _ryE# _wzE# '{7# <|7# _bf}# c~E# }# &# <1#$ Q#( |#, .#0 _up#8 _urE#< #@ ]#C _lb#D E#L -#P E } E1 } E Q } E7 Eq } q Ew W00BxE0c,E fp,In.E} bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includewbuf.cposix_types.htypes.hstdio.h, IKIKKIKoJJKIKte<$z<p(=<'!'$  0@!`#C*8h&c$2%PJ$# 1$ $$! ('! @ ! @$$! @$ $ $D$ | 0P(H | 0P(H0( 4T4`0` UUU ULXSS__swbuf00off_t_size/u/raghu/ics_feb29fpos_t_close_offset__sbuf_readFILEfloatunsigned charlong unsigned intshort unsigned int__swbuf_blksize_ubuf__sFILEdoubleshort intunsigned intlong long unsigned int_seeklong long int_baseGNU C 4.4.3char_write_cookiebionic/libc/stdio/wbuf.c_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__swbuf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 |>xLpx^pYZ p npTj  ~T0z @ p, <, Lp Tpw p  p p0l01 oC S   4F   0 "+5>bionic/libc/stdio/wbuf.c__swbuf_gp_disp__swsetup__sflush__errno !%,3:AOV]dkry!=KYgu       <              $ + / 6 : I M T X _ c j n }       wsetup.o/ 1331265332 1002 1002 100644 5228 ` ELF P4(! % RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I? < -&] Q-intg2v aC@NNW X# YE#0Tw _px# _ryE# _wzE# [{7# p|7# _bf}# ~E# I}# G# x1#$ Q#( 7|#, b#0 _up#8 _urE#< #@ #C _lb#D E#L U#P E } E1 } E Q } E7 Eq } q Ew W00~& 'E#> # _ub$# %#,EPfp, BE bionic/libc/stdiobionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includewsetup.cposix_types.htypes.hstdio.hwcio.hfileext.hlocal.h,t JKKNFIKMKZBw<MHK <'!'b@! b0D0!(`;BJ0L0 O0!! '#h ! ' F0G04 "1$0D @& 0 @$$(h  $K !   | PP H | PP HP ,T,t`|`P`1__swsetupPPoff_t_size/u/raghu/ics_feb29wchar_io_datashort unsigned intfpos_t_close__sbuf_offsetbionic/libc/stdio/wsetup.c_readFILEfloatunsigned charlong unsigned intdummy_blksize_ubuf_wcio__sFILEdouble__sdidinitunsigned intlong long unsigned int_seek__swsetuplong long int_baseGNU C 4.4.3char_write__sfileext_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__swsetup.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p[1Z  np!j  ~Pz 0 p, ,, pXT `p  Dp  Lp \p00  o    R   P &/:BGbionic/libc/stdio/wsetup.c__swsetup_gp_disp__sdidinit__sinitfree__smakebuf !%,3:AOV]dkry!=KYgu    $    <         $ + / 6 : A E    _rand48.o/ 1331265332 1002 1002 100644 4168 ` ELFP4($!% RU$ > $ > $ > .? : ; ' @ : ; I 4: ; I4: ; I  I I !I/ 4: ; I?  int!.nNxT h<! L L } L }  ` AL`3 bionic/libc/stdlib_rand48.cINxJF~RxMKNFNIKKLK<'!XKhqHHqP8s̔(p+s0q!xl!`I!X!(!8!3ͫ4m |  x |  xLP_P\]\dUdhRhxSR$__dorand48__rand48_seed__rand48_mult__rand48_addxxlong long intshort unsigned intunsigned intunsigned chartemp__rand48_addlong unsigned int__rand48_multlong long unsigned intxseed/u/raghu/ics_feb29GNU C 4.4.3charlong int__rand48_seeddouble__dorand48accusigned charfloatshort intbionic/libc/stdlib/_rand48.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__dorand48.data.__rand48_seed.data.__rand48_mult.data.__rand48_add.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 ">xLpx^p$Z " np?dj " ~xz  " $,p0  "P  "pp? P"pV "p   ("#p% 8"1p05<0KEo]mUd # 4[    x )2@Mbionic/libc/stdlib/_rand48.c__dorand48_gp_disp__rand48_mult__rand48_add__rand48_seed !%3:AHOV]dkry   @  $          ! % , 0    assert.o/ 1331265332 1002 1002 100644 5940 ` ELF P4($!((% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' @: ; I!4: ; I? < _t intWe#9sZ H aC)NHW X# Y)#>Tw _px# _ry)# _wz)# -{E# B|E# _bf}# ~)# }# 0# O1#$ Q#( |#, 4#0 _up#8 _ur)#< #@ c#C _lb#D )#L @#P ) } )1 } ) Q } )7 )q } q )w W>>U@T`/q /)>/qQi/qd7?HwJ`%q%)i%qUJ bionic/libc/stdlibbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeassert.cposix_types.htypes.hstdio.hassert.h/tK, %tK assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d <'!'$!$!0$ !8@ <'!'$!8$ $  | TP(DHP(D | TP(D,HP(DT( $T$DR (U 8V <WH( $T$8W (U 8V)c__assert2__assert$THTHoff_t_size/u/raghu/ics_feb29__assert2fpos_t_close__assert_offset__sbuf_readFILEfloatfileunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoublefuncunsigned intlong long unsigned intline_seeklong long int_baseGNU C 4.4.3char_write__sF_cookieshort int_flags_extlong int_file__kernel_off_tsigned char_nbuffailedexprbionic/libc/stdlib/assert.c_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.__assert2.rel.text.__assert.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 t">Lp^p~cZ " npj t" z2h0T 8"H 8"p@  " @ "pL $"p'- "pT( " p|  "p0"0- +o? O ;,# V    "<  'T1:?GMHbionic/libc/stdlib/assert.c$LC0$LC1__assert2_gp_disp__sFfprintfabort__assert  !%3:AHOV]dkry!=KYgu     ',6;EV   ( $ 8H  ( $ 4<   , 0  0      $ + / > B Q U d h w {                 atexit.o/ 1331265332 1002 1002 100644 9992 ` ELFP4('$?@PP% RU$ > $ >  $ > '  : ;  : ; I  I '  I  : ;  : ; I8  : ; I8 I!I/ .: ; ' I .? : ; ' @: ; I4: ; I4: ; I : ; 1X Y : ; I4: ; I4: ; I 4: ; I .? : ; ' I@1RUX Y 4: ; I? < 4: ; I?  %=1intu/gI&'(   }  % n)# *}# +}# !> ">#ind#)#max$)#fns,D# T)N!p>`()ژT08X|,@dso|}p~> q~>fnHn)()M)T<@$=)=arg=}dso=}=p?>|fnp@(A)retB)fT8A 0h0())>u) bionic/libc/stdlibbionic/libc/includebionic/libc/privateatexit.cunistd.hatexit.hthread_private.ht0|Ksk$$FNFIMGKNRGKKKit8-JSJzJPLHLHLkJJ%^, txtIKk tu  xKJKIK=8JJJPz$KFNFLHNLNGIIMxHL\($J],wtIKI <'!'<840,($p*"@!$Ku#@!@B@! !( $0@, <840,($ @'<840,($@'$! !($ $T!@ < &i5I@F8$u@ ! !( $ <'!'LHD@<840,!@uƎ$`Į9@q1&HA#8 !g  &@1&&!s`I@ҎLHD@<840,P' ! `!( $@ ! &! `!( $1&ha#X!Pk P%! `!( $ @ @ ! &1&! `!( $Q& Ѯ!  !(<'!'LHD@<840,!p!*N@!$V%*(P! $! !($ $KV!@J@ &ப<&7plh`!0#!$ ! !( $)@0L  L HD@<840,P'$LHD@<840,P' !( $@$  $``ꮱ" | (P@\,,PPd ,PPd  | (P@\,@,PPd ,pPPd  DTDbbTb\hehReReRe,R,|e, PTPbTb`c`TcT ` T,`laa TTTxbbTb TUTtccUc TVTpddVdlgRdggg@PRRRr)a__atexit_register_cleanup__cxa_finalize@__cxa_atexit__atexit_invalid __atexit,,8<@D,getpagesizenext/u/raghu/ics_feb29__cxa_atexitbionic/libc/stdlib/atexit.ccall_depth__cxa_finalizedoublefn_ptr__isthreadedcxa_funcfloat__atexitunsigned charunlockatexit_fnlong unsigned intfuncatexit__page_size__atexit_invalidstd_funcunsigned intfn_dsolong long unsigned intpgsizelong long intGNU C 4.4.3char__atexit_register_cleanup__page_shiftshort intlong intsigned charshort unsigned intfn_argGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__atexit_register_cleanup.rel.text.__cxa_finalize.rel.text.__cxa_atexit.data.__atexit_invalid.bss.call_depth.2920.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X`5 %>Lp^p`)Z H% npj `!% ~z x!`%  , !%<  X"`%D H pH  "0%   "%p #%,pdv( &%@p0< & %Sp 8O &P%ap0Bl0uop&     !"#- GP\i},bionic/libc/stdlib/atexit.ccall_depth.2920__atexit_register_cleanup_gp_disp__page_size__isthreaded_thread_atexit_lock__atexitmmapmprotect_thread_atexit_unlock__atexit_invalid__cxa_finalizemunmap__cxa_atexit $@& !%3:AHOV]dkryUcj n r{      ,5 9 BM Q U^hw  #    0 D P T ` l !| ! "( #T !8 #< T Xh !4 !l ! !P  %  %8 T ` d p # !L " !  @D pt  D t     ! % , 0 7 ; B F M Q ` d k o v z                          $ + / 6 : A E L P W [ b f m q                          # * . = A H L S W ^ b i m |                          $ ( , atoi.o/ 1331265332 1002 1002 100644 3368 ` ELFP4(!` % RU$ > $ > $ > .? : ; ' I@: ; I I&Ij-intW@e)4s H0 bionic/libc/stdlibatoi.cu <'!'!(  $ ' | 4P D | 4P D4 (Tatoi44long long intunsigned intlong unsigned int/u/raghu/ics_feb29long long unsigned intunsigned charcharbionic/libc/stdlib/atoi.clong intdoubleshort unsigned intatoiGNU C 4.4.3floatshort intsigned charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.atoi.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxm^pZ  npLj  ~4z  p$( L( pt3 0p p   p  p00o$    3   4 )bionic/libc/stdlib/atoi.catoi_gp_dispstrtoimax !%3:AHOV]dkry    =          $    atol.o/ 1331265332 1002 1002 100644 3368 ` ELFP4(!` % RU$ > $ > $ > .? : ; ' I@: ; I I&Ie-intW@a4s H0 bionic/libc/stdlibatol.cu <'!'!(  $ ' | 4P D | 4P D4 (Tatol44long long intunsigned intlong unsigned int/u/raghu/ics_feb29long long unsigned intunsigned charbionic/libc/stdlib/atol.ccharlong intdoubleshort unsigned intsigned charGNU C 4.4.3atolfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.atol.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxm^pZ  npLj  ~4z  p$( L( pt3 0p p   p  p00o$    3   4 )bionic/libc/stdlib/atol.catol_gp_dispstrtoimax !%3:AHOV]dkry    =          $    atoll.o/ 1331265332 1002 1002 100644 3264 ` ELFP4(!`% RU$ > $ > $ > .? : ; ' I@ : ; I I&I3int]Fp!ykSsG1 bionic/libc/stdlibatoll.c<'!!(  $ |   |   Tatolllong long intunsigned intatolllong unsigned int/u/raghu/ics_feb29long long unsigned intunsigned charcharlong intdoublebionic/libc/stdlib/atoll.cshort unsigned intsigned charGNU C 4.4.3floatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.atoll.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxm^pZ  npKj P  ~z X  p   p ,  pL p_ p{  p p00o   ` 5    "+bionic/libc/stdlib/atoll.catoll_gp_dispstrtoimax !%3:AHOV]dkry   >          bsearch.o/ 1331265332 1002 1002 100644 4772 ` ELF P4( 8% RU$ > : ; I$ >  $ > .? : ; ' I@: ; I : ; I 4: ; I 4: ; I  I &' II&IayDint;W2#c7key17 17I n10g 10 +2S t4Y lim5) cmp5)6 p67T = )S77 > _3 bionic/libc/stdlib/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includebsearch.cstddef.hstdlib.h2$E}OKzKIK} K,'0(4,$ !!!HCTr!!U! ! !(`@@4@!!@CTr! !U! !(`@&C@!t!4!`0,($ 8' | (D8` | (D8`88T8aTLUUXVV8W8dW88fDe(8`8<V<b`bV`|RRHcebsearchlong long intsize_tunsigned charbsearchcomparlong unsigned int/u/raghu/ics_feb29long long unsigned intnmembbasebionic/libc/stdlib/bsearch.cGNU C 4.4.3charbase0long intdoubleshort unsigned intsigned charsizefloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.bsearch.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p=eZ ( np7j  zp< < p,g p |p  p p00o` t&    bionic/libc/stdlib/bsearch.cbsearch !%1>ELSZahov}          % 2          $ + / 6 : I M T X g k r v                         # ' 6 : A E T X    ctype_.o/ 1331265332 1002 1002 100644 10780 ` ELFP4(;8% RU.? : ; ' I@ : ; I$ > : ; I 4: ; I?   I&I $ >  4: ; I? < I !I/ $ > C(fS8ScQSintkS8cVS)pS8c[SR uS8c`S{TzS8ceSS8,cjS;S8VcoSS8ctSS8cySHS8c~Sq\S8cSS(cSSPcSToSxcST8 O w9  :   e'Q bionic/libc/stdlibbionic/libc/includectype_.cctype.h<'!$0! b0!<'!$0! b0!<'!$0!  b0!<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! Db0! $ 8,$,0 ((((( AAAAAABBBBBB  |  8 8 8 8 8 8 8 8 8 8 8    |  8 $8 48 D8 T8 d8 t8 8 8 8 8    T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T TT)isalnumZisalphaiscntrlisdigitisgraphislower,isprintVispunctisspaceisupperisxdigitisblank(isasciiPtoasciix_ctype__C_ctype_8888888888888888888888isalnumisspaceisasciiislowerisdigit/u/raghu/ics_feb29isprintGNU C 4.4.3charisgraphisxdigit_C_ctype_toascii_tolower_tab__toupper_tab_isalphaisupper_ctype_iscntrlshort intisblankispunctbionic/libc/stdlib/ctype_.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.isalnum.rel.text.isalpha.rel.text.iscntrl.rel.text.isdigit.rel.text.isgraph.rel.text.islower.rel.text.isprint.rel.text.ispunct.rel.text.isspace.rel.text.isupper.rel.text.isxdigit.text.isblank.text.isascii.text.toascii.rodata._C_ctype_.rel.data.rel._ctype_.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 ,!p9>Lp^pZ ! 9 npj #p9 ~8z ,$9 8 D$9 8 \$9D8 t$9|8 $98 $98 $9$ 8 $9\ 8  $9  8 %92 8. %9!A O ]( k0 4 } 4%9'p8  <%9)(  &p9+p  &09-p (9/p (x91pVx <)93p00o0P:$     !#$%&')+-/135678 %.'68>8F8N8V8^8f8n8v8~8!#$%&bionic/libc/stdlib/ctype_.cisalnum_gp_disp_ctype_isalphaiscntrlisdigitisgraphislowerisprintispunctisspaceisupperisxdigitisblankisasciitoascii_C_ctype_$ '@(`)*+,-. /@0`123 !%+6 : N\g k       '.9=QXcg{ #*59R]ay&4^ |    0Nl%% &%% &%% &%% &%% &%% &%% &%% &%% &%% &%% &4 $( 48 DH TX dhtx ( 8 H X hx      ) - 4 8 ? C R V ] a h l {             #*.59HLSW^bqu|   ( 0 8@HPX`hpx         $ (,048<@DHLPTX\`dhldiv.o/ 1331265332 1002 1002 100644 3196 ` ELFTP4(|% RU$ > $ > $ >  : ;  : ; I8  : ; I8 : ; I .? : ; ' I@ : ; I : ; I 4: ; Ij@intSv.))#rem)# div4 num%)U %)V r'uO bionic/libc/stdlibbionic/libc/includediv.cstdlib.h%~NJIMK! a#f$CD |  4 |  4div44long long intunsigned intunsigned charquotlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3long intdoublediv_tshort unsigned intsigned charfloatdenomshort intbionic/libc/stdlib/div.ccharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.div.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 t >xLpx^p'Z |  npyj 4  z4p  <   L p T p"  \ pB l p0R01oCS P T    4 bionic/libc/stdlib/div.cdiv !%3:AHOV]dkry  \       exit.o/ 1331265332 1002 1002 100644 3744 ` ELFP4(" % RU$ > $ > $ > .? : ; ' @: ; I4: ; I? < 4: ; I?  yBintU02<)3) 0l0-)u\ bionic/libc/stdlibbionic/libc/includeexit.cunistd.hstdlib.h8= <'!'! !  !  | <P H | <P H< $T$<`(exit__isthreaded<<long long intunsigned intunsigned charstatuslong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_size__isthreadedfloatexitshort intbionic/libc/stdlib/exit.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.exit.bss.__isthreaded.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5   >xLpx}^pZ  npyj  ~L<z  p,  , 0 p> 8@ p, x pJ   pj  p0z 0{o& !  K   < )8>bionic/libc/stdlib/exit.cexit_gp_disp__cxa_finalize_exit__isthreaded !%3:AHOV]dkry    i  0         $ + /    getenv.o/ 1331265332 1002 1002 100644 5096 ` ELF@ P4(# ?(% RU$ > $ > $ >  I.? : ; ' I@ : ; I: ; I 4: ; I 4: ; I &I .? : ; ' I@ 4: ; I 4: ; I? < c)intfOE.a..U len1) i1) np2< p3 cp3  ) }60YaK$ M)p0R bionic/libc/stdlibbionic/libc/includegetenv.cstdlib.h.qJt JNHIJ zww <'!!L @!=$.C!=$Fc$b@@#Xd!@!H= $$`F  B$! hFB$gc$)%"@FB$# ,H!<'!'$ '$(' |  0P(D |  $0P(D TT[l[SHSTSTSTSS\$\Y\RlRR0( $T'g__findenvgetenv$00long long intunsigned intunsigned charbionic/libc/stdlib/getenv.c__findenvlong unsigned intnamelong long unsigned intgetenvoffset/u/raghu/ics_feb29GNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intenvironGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__findenv.rel.text.getenv.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp^pigZ  ! npj ! ~z ! 0 !p8  !$8 (!p\7 8p!p+ !p( !p  !p00o*" X?    '080bionic/libc/stdlib/getenv.c__findenv_gp_dispenvirongetenv  !%3:AHOV]dkry       + / 3 <F KZ_      $ (  (      " ) - < @ G K R V ] a h l s w ~                        $ (       jrand48.o/ 1331265332 1002 1002 100644 3484 ` ELFPP4(! % RU$ > $ > $ > .? : ; ' I@: ; I Ik;intN|)wiaHe LkS bionic/libc/stdlibbionic/libc/includejrand48.cstdlib.h <'!' !!C ' | HP H | HP HH (T(@`jrand48HHlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intxseedGNU C 4.4.3charlong intdoublejrand48short unsigned intsigned charfloatshort intbionic/libc/stdlib/jrand48.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.jrand48.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 4 >xLpxf^pZ <  npoj  ~Hz   pP,  |, , p> 4 @p t p  | p$ p040o&6x    :   H &/bionic/libc/stdlib/jrand48.cjrand48_gp_disp__dorand48 !%3:AHOV]dkry    `          $ + /    ldiv.o/ 1331265332 1002 1002 100644 3216 ` ELF`P4(|% RU$ > $ > $ >  : ;  : ; I8  : ; I8 : ; I .? : ; ' I@ : ; I : ; I 4: ; IqGintZ}50a#rema#) 4 num%aU %aV r'vP bionic/libc/stdlibbionic/libc/includeldiv.cstdlib.h%zPKIMK! a#f$CD |  4 |  4ldiv44long long intunsigned intunsigned charldiv_tquotlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3long intdoublebionic/libc/stdlib/ldiv.cshort unsigned intsigned charfloatdenomldivshort intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.ldiv.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p'Z  npzj H  z4p  P   ` p  h p'  p pG p0W0=oO_ P `    4 bionic/libc/stdlib/ldiv.cldiv !%3:AHOV]dkry  ]       lldiv.o/ 1331265333 1002 1002 100644 4248 ` ELFP4(!??8% RU$ > $ > $ >  : ;  : ; I8  : ; I8 : ; I .? : ; ' I@ : ; I : ; I 4: ; Icint6vQLS#remS#D  num%S %SX r'Q bionic/libc/stdlibbionic/libc/includelldiv.cstdlib.h%0EOE=;KIKFKIKLIK <'!'40,($ HL!!(!!!8@! !0`! !( !0`!8@!@ !` 4`#S! 0,($ 8'&+(+S#r4!#b!!`! 0,($ 8' | (P8\ | (P8\8 DVWDPdWPxda 88ccbbcb b lldivlong long intunsigned intbionic/libc/stdlib/lldiv.cunsigned charlldiv_tquotlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3long intdoubleshort unsigned intsigned charfloatdenomshort intlldivcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.lldiv.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p'Z  np j ` ~z h  p< < pD p pp7  xpW p0g0Pobr   @=   %. 4bionic/libc/stdlib/lldiv.c__divdi3__moddi3lldiv_gp_disp !%3:AHOV]dkry     ^ 8 d         $ 0 4 @ D X \ d h u y              locale.o/ 1331265333 1002 1002 100644 2748 ` ELFP4(% RU.? : ; ' I@ : ; I  I$ > $ > &I|2>4``mT tUfintzfhR bionic/libc/stdlibbionic/libc/includelocale.clocale.h! |   |  )setlocalesetlocalelocalecharcategory/u/raghu/ics_feb29GNU C 4.4.3bionic/libc/stdlib/locale.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.setlocale.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxd^pZ  ` np\lj t  zp  |   p  p0  pP p0`Z0oP  '    bionic/libc/stdlib/locale.csetlocale !%+6 : FSi_       lrand48.o/ 1331265333 1002 1002 100644 3480 ` ELFHP4(!| % RU$ > $ > $ > .? : ; ' I@I!I/ 4: ; I? < m;intN~)yelaPL}lS bionic/libc/stdlibbionic/libc/includelrand48.cstdlib.hu>$<'!'  'ĔŔB!C | PP D | PP DP lrand48PPlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intlrand48GNU C 4.4.3charlong int__rand48_seeddoublebionic/libc/stdlib/lrand48.cshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.lrand48.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 H >xLpxo^pZ P  nppj   ~Pz  ( ph( 8 ( H p  P p p p  x p p0&0o 0p    H   P &/:bionic/libc/stdlib/lrand48.clrand48_gp_disp__dorand48__rand48_seed !%3:AHOV]dkry   `   0           mrand48.o/ 1331265333 1002 1002 100644 3476 ` ELFDP4(!< % RU$ > $ > $ > .? : ; ' I@I!I/ 4: ; I? < Xint+8kFjaLL}lS bionic/libc/stdlibbionic/libc/includemrand48.cstdlib.hu> <'!'  '!C | LP D | LP DL mrand48LLlong long intbionic/libc/stdlib/mrand48.cunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intmrand48GNU C 4.4.3charlong int__rand48_seeddoubleshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.mrand48.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 D >xLpxo^pZ L  nppj   ~Lz ( pd( 4 ( D p  L p l p  t p p0"0 o,l    H   L &/:bionic/libc/stdlib/mrand48.cmrand48_gp_disp__dorand48__rand48_seed !%3:AHOV]dkry   `   0           nrand48.o/ 1331265333 1002 1002 100644 3488 ` ELFTP4(!< % RU$ > $ > $ > .? : ; ' I@: ; I Ik;intN)kaLe LkS bionic/libc/stdlibbionic/libc/includenrand48.cstdlib.h$<'!' !B!C ' | LP H | LP HL (T(D`nrand48LLlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intxseedbionic/libc/stdlib/nrand48.cGNU C 4.4.3charlong intdoublenrand48short unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.nrand48.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 8 >xLpxf^pZ @  npoj  ~Lz   pT, , 0 p> 8 @p x p  p( p080o*:|    :   L &/bionic/libc/stdlib/nrand48.cnrand48_gp_disp__dorand48 !%3:AHOV]dkry    `          $ + /    putenv.o/ 1331265333 1002 1002 100644 3812 ` ELF,P4(!t(% RU$ > $ > $ >  I.? : ; ' I@: ; I4: ; I 4: ; I 4: ; I &Ie;intNq)z7)str# p% % &)3 zR bionic/libc/stdlibbionic/libc/includeputenv.cstdlib.h#vyHLyzJP <'!'$  @!@! @ =$@E$! $ @!  $ (' ! $$ (' | P(H | P(H( (TRputenvlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3long intdoubleequalshort unsigned intsigned charputenvfloatrvalbionic/libc/stdlib/putenv.cshort intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.putenv.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 L >xLpx^pZ T  np~j $ ~xz ,8 p$, dP, tp|F |@p p  p p00oT    G    $-4;Bbionic/libc/stdlib/putenv.cputenv_gp_dispstrdupstrchrsetenvfree !%3:AHOV]dkry     _  4 L l          $ 3 7    qsort.o/ 1331265333 1002 1002 100644 25112 ` ELF4P4(!p% RU$ > : ; I$ >  $ >  I.: ; '  : ; I : ; I  4: ; I .: ; ' I ' II&.? : ; ' @: ; I4: ; I4: ; I4: ; I  : ; 1RUX Y 1 4141 U  Uint;vaN<o".9& a9 b9 n9) 9) il pi> pj> t>lLd aL bL cL cmpL)yyyd(gl aaT!nT04esT0cmpTpaVpbVrpcVpdVplVpmVpnV dW)rW)W)YW)$aX7 xoP0nH`tolPx\|v}$^ | ) s 7 ( |\    <`8 P D l   h> Xht`lr Xhtl yH <pctlLp|_}(E7twl,H m_XOF=,d@iXOF=,pjXOF=,kXOF=Dw_T|.Rpx0, @XP 8 &epL \ tl bionic/libc/stdlibbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includeqsort.cstdlib.hstddef.h<}Jv tJLJ JqJbJJaJJL <wHkJJH KJ=(LJJJ=I^J#Jv^)Jw<[%^J)$w< JwJ J:S0 LHHPzJ䈄>IKIKKJm=HLNB<^hJv<L4OJ4^s$J<tfJIfJe<tdJJddtJc<v<k<G:DJ6]t=t=<=l<X<<<<dJKJJ)J&<J)$&<ZJ&JZJ:JJ<'!'lhd`\XTPLH8+!@PH<!#0*B2d04!!0$$]#0[ $<.Z Bhs$!4!N ,@ȏ?Ȭ߯!$!,(!`! @+$( r##(*p  @!# (ɀB$Ƞ$@$##w#R*  @ xU#d%B$m@c$*E*(WK#@d0 $. r!p+h7!#!$+X(`! !`8?!# +`!!`!w! `!  !(@ #w!@!` Jc$ I&`B$!# +`!`!!#+`lhd`\XTPLHp'!  @@@Tkg$!p$!+g$@!  ! @@@ @S!(@! `!N$OB$$$I!8 @׌$!h$!6! ! !`!(^$M$B$$ S! @E$LB$&@ (̍ޭ($!HR($!(! !!(K$J$B$&s).H!$!$!  2@!  !(@ @S!@G˓c$KǣB$`'!$!  !(A$@!0@!8  (،B$߬$@$#!  !(@$!  !(@$! @Rp! !(( $(@H !@8`@$!  @(!(#` !X,!  ! `(!?@((!  ! |@,8!p(#(!  ! I@(!  !(d@! (L(!(@_$HB$$V(yB$f$@c$*E!Dŏc$EįB$`'G!! !  !(`@!  (A,($!  @!  "@$!  !(@! !  !(8A$6!(!(Y$X$B$ (!  @z$!  !(@$!!  (@(,`r+p{!`!r#$+`)! !`Íϭ!#P+H !!`!w! `!  !(@ #pw!@!`Hc$_&`B$!#P+H !`!!#X+eCl#w!! xY$yXc$B$!#w!! hF$fHc$B$! | 0l Pph   | 0l Pph  l  hT UDf@f@XUU8U8f$|f f L U| U U \V\(b8l b W,a,8W8l a8RDRRP|R L R| R  R8RDR<R|RTL|T L R| R  Rgg8gRg4W4pgpWgW(g$gD|gxg , gS88S`SSTDpS$S  S4@`@PRPP`PXcXh`hc`R8R$ 0 `0 @ R@ D `D L cL \ `\ c ` R  R  ` 8 c8 D `D l cn <n@``0`(HnxnnPnnnHnnn0 x `| ` l `gnDff4HgHxnxgng$f$PnPg<n<<g<Dn|fHgH\n\xg gRRXRRDRPXRtRRRRRRDPR|RxR L R| R  RPeee8D e eVRXVVDV(XVVRVVXxV|VV L V| V  VSS W8DWWRRnnTTXoo o8Do(,oooo|o L o| o  oPTT8TTT|TYXYYDY(XYYY$YXxY|Y L Y| Y  Y|R$RV\V|XVVDV(XVVV$VXxV|VV L V| V  V|TT8TT$T|TXhhDh(0hhh$h|h L h| h  hS8SS|S](]8]]RXRR8RRRT8TTTS8SSSV\V|XVVDV(XVVVVXxV|V L V| V  VS@XYY8YhxS< l S@XRhR8R@ l R@XXhX8XD l X@Xh\h8h W\W<U8UhUU L U| U U@^8^h^^ L ^| ^  ^4T8ThT@pT L T| T  ThlRDpR]](]8]h]Lp]]$]|] 4 ]4g$T|T<U8U<UU L U| U U$T(T8RDR<R(R L R| R  RZXZZDZ<ZXZZZ$ZXxZZ L Z| Z  Z\\\D\\\$\|\ 8 \UT|UoXoo o8Doo(,ooooXo L o| o  oT|T8RDRRR L R| R  RXhhDhh(0hhhh|hh L h| h  h8S0 L St S  S o0 L ot o  o| d 8U8HdHpUpd(U(dSdU d 8 T8 D dD l T8S0 L S\ S  S 8 S8R0 L R\ R  R 8 R8h0 L h\ h  h 8 h8S0 L SP S  Sqsortl x|x|P|$\dht|<@8 l hlhlD L P \ <pHPT`px(|| Ht$\dhHpx DHxDLxT|T\`l, 0  8 \ ` \ `    ( l size_tbionic/libc/stdlib/qsort.cfloatqsortswapfunclooplong unsigned intshort unsigned intunsigned chardoubleunsigned intlong long unsigned intswap_cntlong long intswaptypeGNU C 4.4.3charmed3short intlong int/u/raghu/ics_feb29signed charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.qsort.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 `;>xLpxj^pZ h;p np j @ ~l z @ pD @4D Apx Ap. \p.  \p. \0p0c20e3ow339p  4;+   l  "bionic/libc/stdlib/qsort.cqsort_gp_disp !%1>ELSZahov}-            # 1 G LV [q v|            $ (G K b gp w {              " '0 < @_l {               * 9B I M [ d ir z ~             ! 2 < @d h      ( / 3 A J OX d h                    ! % 4 8 ? C J N U Y ` d k o v z                          ! ( , 3 7 > B I M T X _ c r v }                             # * . 5 9 @ D K O V Z a e l p w {                           ! % , 0 7 ; B F M Q X \ c g n r y }                             & * 1 5 < @ G K R V ] a h l s w ~                             $ + / 6 : A E L P W [ b f m q x |                             % ) 0 4 ; ? F J Y ] d h o s z ~                             ' + 2 6 = A P T [ _ n r y }                        ! ( , 3 7 > B I M T X _ c j n }                                 #  *  .  5  9  @  D  K  O  ^  b  i  m  |                                   )  -  4  8  ?  C  J  N  U  Y  `  d  s  w  ~                                 (  ,  3  7  >  B  I  M  \  `  g  k  r  v  }                               $  (  /  3  :  >  E  I  P  T  [  _  f  j  q  u  |                             $  +  /  >  B  I  M  T  X  _  c  r  v  }                           $ ( / 3 : > E I P T c g n r y }                           # ' . 2 9 = L P _ c j n }                            ' + 2 6 E I P T [ _ f j q u |                             " ) - 4 8 ? C R V ] a p t {                             ! 0 4 ; ? F J Q U \ ` g k r v                             ' + 2 6 = A P T [ _ f j q u                             & * 1 5 < @ G K R V e i p t {                                  $ 0 4 8 < H L P T ` d h l x |                              $ ( , 8 < @ D P T X \ h l p t                              $ ( , 0 4 @ D H L P T X \ ` d p t x |                                $ ( , 0 4 @ D H L X \ ` d p t x |   seed48.o/ 1331265333 1002 1002 100644 3828 ` ELFP4("% RU$ > $ > $ > .? : ; ' I@ : ; I4: ; I  I I !I/ 4: ; I? < ~Ninta<mtx)L L }   /L~R bionic/libc/stdlibbionic/libc/includeseed48.cstdlib.hKIIKKKMGKOEKMKGKHMKGO<'!8.-%NM,+$ $m$$*Ǥ |  t |  t XTseed48ttlong long int__rand48_multunsigned intsseed__rand48_addlong unsigned int/u/raghu/ics_feb29long long unsigned intxseedbionic/libc/stdlib/seed48.cGNU C 4.4.3charlong int__rand48_seeddoubleshort unsigned intsigned charunsigned charfloatshort intseed48GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.seed48.bss.sseed.2256.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 t  >xLpx^pZ | npj \ ~tz d@ p   (   pH  p[  px   p  p0  0o&P !  a   (t /8FTbionic/libc/stdlib/seed48.csseed.2256seed48_gp_disp__rand48_seed__rand48_mult__rand48_add !%3:AHOV]dkry   _    $ 4 @         setenv.o/ 1331265333 1002 1002 100644 6824 ` ELFl P4($!0H% RU$ > : ; I$ > $ >  I.? : ; ' I@: ; I 4: ; I 4: ; I &I 4: ; I 4: ; I 4: ; I4: ; I? < int*;1gP?9)b^ P`> a)Q ~8)h|b,,,) . C/# H0) 0)hcnt>0 P?$ bionic/libc/stdlibbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includesetenv.cstdlib.hstddef.h$z,4OHLyJQ$=: Jv,tJIKtJJc<}JIuLHK<'!',($ !' C!bB$EE!  !(@,($ 0'<'!'D@<840,(!&=8 C ! ! ! ' !@!@S@  ! @* R&fs&!D@<840,(H'"]@=$[N=$! d#QB$C`#Qt'x! V ! @B!b" @b=$ D1&"D"c$b@1&=$qc$&fc$!$u!B$HB$B$#U&Ď ( @!@eʎE! @ 0&` !XԮ`t!  | P0P(hPH` | P0P(4hPH`0 4T4xaDdR4DhD\T\hh TTTaaha <U<`h` PVVV|cRcSc<R`SR`hRUPHHlclUcXheRhhe&unsetenvsetenv$hhlong long intbionic/libc/stdlib/setenv.csize_tunsigned charunsetenvl_valuelong unsigned intnamelong long unsigned intsetenvfloatoffsetGNU C 4.4.3char/u/raghu/ics_feb29long intdoublerewritelastenvshort unsigned intsigned charvalueshort intunsigned intenvironGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.unsetenv.rel.text.setenv.bss.lastenv.1834.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 ">Lp^psZ " npj " ~z 0 " \h Px"p\  " \ "p| p"p * h"p ( p" p   "p0 "0 +o! 1 ; # r    * 3<DNhU\ckbionic/libc/stdlib/setenv.clastenv.1834unsetenv_gp_dispenviron__findenvsetenvstrlenmallocreallocmemcpy  !%1>ELSZahov}    ).8=I V[fpu y   0 T D d   $ H    $ ,  L   4 8  8      $ + / > B Q U ] a h l |                        # ' . 2 9 = D H O S Z ^ e i p t {                            setjmperr.o/ 1331265333 1002 1002 100644 3336 ` ELFP4( p% RU$ > $ > $ > .? : ; ' @ 4: ; I? < Hint[6)5$:r:wa bionic/libc/stdlibbionic/libc/includesetjmperr.cunistd.hsetjmp.h*longjmp botch. <'!$$ $ |  $ |  $longjmperror$$long long intunsigned intunsigned charlongjmperrorlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_sizebionic/libc/stdlib/setjmperr.cfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.longjmperror.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx[^pZ  np{j  z2$ (p8  X  px# p  p p00 o   A    %$2;bionic/libc/stdlib/setjmperr.c$LC0longjmperror_gp_dispwrite !%/=DKRY`gnu|  n         srand48.o/ 1331265333 1002 1002 100644 3436 ` ELFlP4(% RU$ > $ > $ > .? : ; ' @ : ; I I!I/ 4: ; I? < Dsint)apPaTL}   7L|S bionic/libc/stdlibbionic/libc/includesrand48.cstdlib.hMMFMKzJMKHMKzJMKM<'!\ $ $3$m$$Kj GfeD |  P |  Psrand48PPlong long int__rand48_multunsigned intunsigned char__rand48_addbionic/libc/stdlib/srand48.clong unsigned int/u/raghu/ics_feb29long long unsigned int__rand48_seedGNU C 4.4.3charlong intseeddoubleshort unsigned intsigned charsrand48floatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.srand48.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 , >xLpx~^pZ 4  npj  ~\Pz  ( p  ,   < p D p   L p* \ p0:0BoTdD   X   P &/=Kbionic/libc/stdlib/srand48.csrand48_gp_disp__rand48_seed__rand48_mult__rand48_add !%3:AHOV]dkry  `          strntoimax.o/ 1331265333 1002 1002 100644 3916 ` ELFP4(!% RU$ > : ; I$ > $ > .? : ;' I@ : ; I: ; I  I &IJint&;6i]87^t- !  })&n09   O9 bionic/libc/stdlib/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includestrntoimax.cstddef.h_types.hstdint.hinttypes.h <'!  |   |   T U V W#strntoimaxlong long intshort unsigned intnptrsize_tstrntoimaxlong unsigned int/u/raghu/ics_feb29long long unsigned intintmax_tbaseunsigned charcharlong int__int64_tdoublebionic/libc/stdlib/strntoimax.cint64_tsigned charGNU C 4.4.3floatshort intunsigned intendptrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strntoimax.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p#Z  np$Sj  ~xz  p    pL @p! $p=  ,p] <p0m0 o   d @   ! ,5bionic/libc/stdlib/strntoimax.cstrntoimax_gp_dispstrntoumax !%1>ELSZ_lsz      F         & * 9 =    strntoumax.o/ 1331265333 1002 1002 100644 6884 ` ELF|P4(!% RU$ > : ; I$ > $ > .? : ; ' I : ; I.: ; ' I  4: ; I .? : ; ' I@  : ; I : ; I : ; I4: ; I4: ; I 4: ; I1RUX Y 1 U1RUX Y  U41 I&I4: ; I? < 1@hint;} D8p['9>8e)c)R )ch ) d"; d18 1 1U L1)J n10p3end4W05)>v6gd7):c?38VPQI68"9"Po:/6 bionic/libc/stdlibbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinestrntoumax.cctype.hstddef.h_types.hstdint.h1PJJJy}uI}JM sQ/J0HKIHNJMGH%x OL=h iK<'!!8+@!c!PkI(1 $$t!po͑1m$!8 $$+0GS0$$+PG@ $0$V!P@+U@!P!@!Hb$xs_p` p!!hn!L!pm+xb!hD%*XF!p`!x#`+!@!`!H!PCb$l$ D,-m$`-@! @b$+$+pG0$x$H!@X $I+!H! @ #0 #+#!@@!H !! $x $iX $k$$!@!H-$(+$8-9;9/$ |  8 |  8 HT`dTlT 0TTT0T VVVV8V W|T|ZRTZ T TZT`T`xZxTZTR8Tpii08iXYX]^_TXY^_XYXiXYXY<RLTRRRlpi,i],<\<T]]5strntoumax8 $(lp8$T$T8uint64_tshort intsize_tisspace_tolower_tab_minus_ctype_floatlong long intdigitvallong intstrntoumax_toupper_tab_unsigned charsigned charlong long unsigned intunsigned intendptruintmax_tshort unsigned int/u/raghu/ics_feb29nptrcharbionic/libc/stdlib/strntoumax.c__uint64_tlong unsigned intdoubleGNU C 4.4.3baseGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strntoumax.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 d>xLpxX^p5Z l np3j  ~88z  pp    $p ,p5 ! ,pV  4pv x Dp0 Q0?  oQ a   $=   !8 ,5bionic/libc/stdlib/strntoumax.cstrntoumax_gp_disp_ctype_ !%1>ELSZafsz   -7 D Q cm z      (C           ! % , 0 7 ; J N U Y ` d k o v z                            $ + / > B I M T X g k w {                      $ 3 7 > B Q U \ ` g k r v         $ ( , 8 < @ D P T X \ h l strtod.o/ 1331265333 1002 1002 100644 153060 ` ELFd>P4(>;W(00080`80% RU$ > $ > : ; I$ >  I&I : ;  : ; I8 5I  : ;  : ; I I!I/  : ; : ;I8  : ;I8 : ;I.: ;' I : ;I4: ;I.: ;' I .: ;' .? : ; ' I : ; I.1@1 : ;41 1.: ;' I@ : ;I!: ;I"4: ;I#1RUX Y$1% U&41'1RUX Y(4: ;I).? : ;' @ *.: ;' I@+4: ;I ,.? : ; ' I@-4: ;I. : ;/ : ;01X Y1 241 3.? : ;' I@4: ;I 5: ;I 64: ;I 74: ; I? < D Px int%&=3)40;1,4S5^"y) *# )+  d҅ ul "k2l#km)#m)#m)# wdsm)#xn#- q-4)x8k;)cmps)CawCbwCxazIxa0zIxbzIxb0zIi{)j{)wV)yZIk])x^i2bCi)bCFpxyCC)c)I) c)s2b Czs nd0 )nd )y9 bCi)k)xyulp_xx"La"7aCbCda"db"k)ka)kb)u,vCK! kCk)x)rvCKI]igq|ld2bfCL _dj ejT!{j}"bmC"den)"in)"kn)7xoI"yo"zo"dp"3#O$a%(&k&u#PK%ht'O\$a%&k&u) CaCbCcCk)wa)wb)wc)(yzxIxaIxaeIxbIxbeIxcIxc0Iz2t  ;*&4&?JUakJu%NlCbCm)a)i)wds)xIyxizb1CTkQd  . L )b s *QC\ . bC k)@ "b1C "p5C "p51C "i)O +p05> #4 $A# $$%0& *x &4&?J U a k uD &'KH`$%g$&q|'$%& )> . * 0CM b4Cm k4)"i7)"k17)n7)"n17)"b18C/"x9Iy"x19I"xe9I"z9'n$ADC aCbCcCi)wa)wb)(yxaIxaeIxbIxbeIxcIzb2d4 a!Ce!xa$Ixa0$Iw$y$z$k%)d&"`Z,D+ s008 se8+"bb2;)"bb5;)/"bbe;)"bd2;)""bd5;)-;)+bs2;)"c;)-D;)"e<)"e1<)-<)D"i<)3"j<)"k<)"nd<)|"nd0<)R!"nf<)!"nz<)""nz0<)Y#-<)#"s=$"s0=&s1=->&-{>(adj>+rv?"~+rv0?"~"L@)"yA_*"zA ,"bb1BC-"bd0BC-"bbCC-"bdCC ."bsCC.-CCd0(F.retn ///:P/h /OY/b#\T.$0dH$# (m$<$1$%1%H&G&Q[2e42oR2#hq$$0s$1&# $. $$ %&8 B e2L 2&W b 3n 54x ^4 5 ~6 6 6 r7' $$%58 i88&.88&"#@ $$%(8 {9(:.:8;&"#z @U$%h2VWP<n<# $$%2~2~<=># /$ $ %  p> >&  ? ? ?2! ~+ | ' P7$%p&' $ $ % ? @&  GA A (B2! ~+ L ' 7$%@&#z`Q$%2~gB2~0`c $A0,d&$A0,e@$A0fZ$A#z0$%2~B2~0L$$1LB BB.C8RC&"'z$%2VWCCv)bzCSzCn})(~y~(qysbxIbxeIsxIsxeIzsizs3$CA _d D!r)'D!)ME4+!]F5rve+-QA)F+b2A)("b5A)GG"beA)AH"digA)H"iA)I-A)oK(A)"jB)K"jj1B)M"kB)Nk0B)6B)86qB)4"m2B)jP"m5B)CQ"s2B)Q+s5B)0-C)R-JD)S6D)6GD)"LELU-8G)hV"xHWW"bJCW"b1JCY-JC'Y"mhiJCZ"SJC{\"mloKC]"dsL@_"sMz`+s0M-NCb-O))c+dP" "d2P"Rc"epsP"c/ l 4/ / ("/? p  .ret /0R #Wr # @4 $. $$ %&8 B cL c&W b dn 5ex te f g .g Ag ;h#K$%0g5i&q|' p$$%^i& i&.8i&"0p $$A0$ M$1$&# $$%i pjj.k8l&"#1/ $M$C%Wmaompwqqr7stuvwMyvy' @$$%X9z& {.|&8&"#@ p3 $$%} }}&.8~&"00 6 $A# \ _"$$%t,? &#t ` "$$% 0ׅ]6&# 0 a 1"$$%X N3&0T5 $$1T ڍ&.8&"#  $% &# H $$%  J&.8&"#1< g $M$C% WamwXv32є'@ $$%X & O.x&8&"#p p 8$$% ͕ 5&.8i&"# j "$$% J~FY&#  % ̘#P0  %$$%H ) ].8&"' ` * $$ CQ6sA6fv61+p5sC6 6 6Z$6% 7879/ 5 E7c:/ 3 bionic/libc/stdlibbionic/libc/includebionic/libc/arch-mips/include/machinebionic/libc/include/sysstrtod.cctype.hstdlib.h_types.hstdint.htypes.hpthread.huwGOFLL(~N rK=K~ mJJxr<JmJI{J:J LHLzPKLKLKLJz򻼻JrJJrJIzI-OKLKLKLIK{OKLKLKLKIJ{Iu򄃃K<{<= ,w FPGKL<IJIIOEO@HMLMGIKwdJJiJJHL,xJRKKM JvJKyJ IKMs$u?y <EO$^4KI}LJxJ}JLJxJqJ $IGN}JJ}JHLH}JJ><IJLHLIIOEO@HMLMHIKIKwdJJK}HLMHJ}JB4J}J}00K=~=KJ~JKJ}, EOKIKJuJKIc LHLGM|J|JJ|JwGMHL$ IKIK| Tv JvJ JfJJvJ vJvHL <$IKK|PHLCJ=J'J<'J{IN|K=JvHJJJKINFJJPJ $u LFI|RtIvJ JK0IKJI??IKwJJJ? JtJ J|<=N$ vJ JkJHJJJJJtJ Jt v xt=KIJ JKOILwHKM(0(ztZ KJwtMztwGKLztvGMz>KIKKyK$?OGMGMzJLMLKOvHxvKHMGMzQyIKzQzJzK{KJ|II kt tuI yM~JJ~tMzKxKt{= KFM~KKJtIOzKJ~>yKQLHGu< tE=J6HLKIKJJ|E=JJ{}$ <|JJCzKJLHLHL~K~uIK<zP`xxJmJrJKK漃K{$I0wsJrJvg$zK#KIIKKIK {KKKJJ4@LJ4JLJ4JLHLN @~N+>ILILM0GGIKzJPK yJKM(HLHLMNFMI!Qu I JIKG J<MGMIGIN=KIvKIKIK0t KvJ JwJ}hKNpJ>wGMKKL~8MIKIKLHKMIK=IqKIJ|JJQKLHK JurKQLHGOv  {{J{JJzJJJ{JsJJ}sJ JwOEOqLO  vJ JvvJNGLGMHLHLHMEOKK uJK JwLHLvNSJ*J  vJ JvvJN=EOKIK uJK JuwQLHGOvZtQHLLv JowMt  KIKoKKM JvJI>yJIR IKJoKKM JvJIK>yJIR IK`JKM JvJI>yJ IKJoJ Jr JrDQHGuJ ~ KPhqJJqKI .MILLHV>HyJt@(IL}OuJmIKFuJ KƒrQLHGOv  *=Yto( {JJ{J$,r?OGMGMGMMFMLKvHxvKHMGMlzQyIKzQzJC"Yt$$z$$z$Jm t|JJOEOqLO  vJ JvvJNGLIKEOKK uJK JwHLvNSJ*J  vJ JvvJN=EOKK uJK JuIK~JrQLHGOv zJIzJJnKKM JvJIK>yJIR IKIJOoJNzzt(@0( u J~p6F Ef $DDx <$  <L@ <l5+PL@DD>"F E2F F!9Fx|x<&p x|P & ѮP,L$@%@|xtplhd`'4S**(!0!D @`*(C!@@( @e#h#h(#H4!('XL ! ! @!@Y$ !( ! !@I%!  <LX#(d! X% $!@TX $MM0 @! X% !(@X!@DCD90C <$!8C02@ $#K(C`(M$! !m(!M( ! !( 9& XX!@`! & !(`!@8`4.Î#@j$H !x!)'%'&B$c$Ed+024&@! & !(@!@D!, !1&!8840!@!$FQE!$<!,1$n'r$Z!8:(3B$!0!@#8@ FY0x'!h@"F$'E0B$"F@$s80 $i z!08 !` 9$spH*(!W'R&H" ! \9& $!@T\c2ÎF#q@l$x !h! /$%(&B$c$De+0c2`9$SR&<\ ! 6\< ! < ! !(! ! $& !0!@!8@!!8!!!0!(j$%XPL\ ((( X$!^XPL\ߏ_XPL\ %XPL\h͌ %%H !X!i ů 'k%c$$'! L #(8!($c$$+ELB$iŌ910#x.!`$ L % #(8!($c$$+EL% B$+0j!X@ !``#K$ !0c$$+xjFEB$i-1!(4$ %0!0c$$+xjFE% B$' !p*L$ !cK`B$B$J@%ȯ!!0q$:0't +$`!B$B$ %Y B$+@"$%Ď!08\X$ '!@XNT\?'X\0 D$  %&< ! \XX\y$ %!@XAT\n% $X0 D$ \\< ! XXy$ $/TX$X0 D$ & \< ! \X+ $$ D!(+`!!0,$!@<40$*0wŽ$!(@*!HF$h!!-8' `F$x&,&h6!H@!(! !1#x! +x  $.1ȫqt1!Xq!0!py 2#X )%!a%1#x!!+x %$(!(% !H!(@#H% $x !p!/B$%B$$E[+X`%! @! !p| #X!Hn t +hIEB$K11#!(|$!pl %p| #X!Hn!t +h%pIE$ ! $+H !B$B$ &Y B$+$&0s&f& *0wD6R&!8! \& $!@T\p2ÎJ#C6@i$ !@!0b$%(&B$c$De+0p29$,!@CdB&,1$'0$*0wD0$R&(4"&3!! K$x1h@x!4 !p`@!(,L!X% 1!x *O B$!H $*d&@k& q&!0?1Ьc$! !H c$!  Z%+ ! B$B$ &_B$+X`$&Ŏ4!H.\XTP$ %X\TTP,%0X\TP D$ %& L< ! PLT\X+`0$!`BDC&<Ď$!h$XL`! <$(F<$$pO <$$I$@@<$_@!8C$#D0$ER&2$+XM`0' *! $& !04!@T2C#C@h$h!X!`-%c%'&B$c$De+0B$',2!8$K<$h/%XPL\  T!@XPL\@T(HWN+(%$$Y$ Ŭ$DC@I@H%$! Xy% !(!@$< Xr$Ն"F@\0$4 $A4#H!I!0!0MA! & $! !0!@4@'?H$H$$! B0F$&F!! !(4d 0D$ FI%!\F@0F8D! XDN,0$" .F&F< F\E2%jQ"F< FGE $D!0$Q"FE9$FD&F&F͓ F!zF(FxD0%< FDER&=9& X!@Xx$vX9%  T!@'0 D$  &! @Y$ $H1 H 9$ns&TS $#DM F$FR%"FHD!2DF,D0'$1 F',d!@!0$F @ FD!F0$MB$F@ F!H1 F<#"F E9$&F< FED0$!`UC&(6$#8!0c!@O$!$<! 8$Pl    54 | P(L 4P0TXLP0H54$xtP8X$TP0X 0\P`h  $ P8XT4P@5 4 7 6 98;:=<?> 8$Pl    54( <T<x`T0 4T4bbdccT``R`L0 8,-8T45\45L45 ,VVV ,WL\WWWPTR\RLRpY\YYLYTT(0TUU0U<UUUUU (U0LUXTX\TXXT0X0TTXTXTX T (X(DTDLXpS\STSS(T0SSTST S (T(DSDLT`dT]8SD\SS\UUUt8 xTx`T`T`T xUUU4aRaRaTRXtRhXpb bdbDVTtV[[VtVZh[hZtZ(W(0c0xWxcWtW_S_T<_<tT]`l`\t\U(UPtU^t^S(t]_<_Dt_ VDTVdVWVtVT0 pTpbTTb U @V@|`|V`VT`LSSDa@aHRRhYP]pTTddR<d<LRLTd T\ \T\cT8c8\X\cDcDLXLpTp\c PUPaUaLaLTUTa\aH`` f `fUR`DUDXfXh`hhfhtUt`f`@U@LfL|`|UUR@`@PRT\fhbbLb|$b$@R@\bHRDPRX|RR8LRRTpRRL`RDPoPd_xYY|YY@S@dhPSh|SSLSVLiHVVi ,i,PVh|VV@V@Li@hHLhPiPhh|hhLhWDoHWWo<o<PWPhoh|W|oWo@W@Lo`T@dXdHTHPXhtTt|XTXXLT \P\h|\\\,@\(]8l]@P]h|]]L]P_4P_h|__L_l^0P^h|^^L^ \[Rd[dR[4R4D[DP\h|\\[@\VHdVVVWVWPVh|VV@VZZZ8 TTT`T` pU0UdUL|RST|T0XPHbdxbbdRpddRdS0SS0RR0VV(T |T|cHc c< cccc(cHcccc$c@pcxc cdcc U`fdff0dRdWRWR W  R0 P W` | W W W W Wp R W RRRWWWd|WWW4U U0 H U` p U U Up UUUUH~~~~(D~~~~d~,V V0 D V` | V V V Vp VVVVVV(X X0 P X` | X X X X Xp XXXXXXX(XdXXXH~~~~(D~~~~d~HaVaV T atxTxaaxaxYT$a$Taaaa$T$VaY(aDPTTaTaTYTaYPaaVaT@a@hThpVpxaxYaaT@ T tTT,<TTTTT4TT4TTTT(TTTdxTTHddtdd<dT dp dddd(DdHPdddddd(d@xddddddR8RRRR$RH__t__$___p__DP____ _<___\_px__d_PT4TZtT T0 8 T` l T T TT Z T X Z| ZPZZ,HZZZHZx(ZLZ4hZZZZZ(,Z(Z@`ZdTZ8TTZdZZxT4T\dWx WdTTdTHRtRLRRRR R@pRH`VnVn`t`nTn`Vn`TV`,`,\b``n`nT(`DP```T`nVnT``nx`xTn`d`Hpntn\nnnnnnxnndnH]]t]t]]P]Xp]]](]DP]]](]<]]]]@]]d]HZZ\hZZZ(ZDPZZZZZZZHXPXXXX(XDPXXXXxX|gg(g`\b\YbRbYbl`ltbt`b(R(4Y4<R<`Y`Rb Y DRDYb`b$b\bY,R,bYRb(Y(DbDPRPXbX`bRYbRxbxRYb`HSStS|S`SSSS(SDPSSSSSSSSSdS !  !|  ! `VW` ! !,H ! !VW !VWVW VW$h !pVW ! !VW4D !PXVWXp !xVWVWVWVW !VW(D !( !VWH8989_^898989(D89898989d89TtxTTDTT4T(lTtTTTTTT@hTUtxUUUdUU DU`UR R RR,HRRR RRxRRRRURUR(UDPUUUURUU8U@hUpUUdUHWWtWW4W@WWTpWWW(WDPWWW\WTWWWTWRxcRcR0c0LR`RX cp ccc(DccRccdcV,VVVH``R< `` `,4```X`X`(R(```(D````d`HaSS0R0SR S0 @ S` p S S  SH  S, p ap xSS,@SX|SSSSRS48S\SSS(DSS@XSSSdSHdU( 0 U0 < R< U RX p d |UU,@UUVUURUU4UR8U8DRLTUT`R`UUU(DUU@XUUUdU[` ^ 0S0`SHpTpxT8pRpxRHpV WW(@WtWWW< T Z ZZZ(ZZdZZ< Y Y Y| YY8@YPXYtYYYW(Y,0WLY Y$8YY4YYDYY(YYdYYY< @ T@\TlT^< h ^h p V ^ ^ ^ ^| ^^^,H^^^(^,V^hVh^^^4^^D^^^(D^(^d^^^< t [ [ [| [@[ `[l[d[[4[[D[[([[dp[[[0X$]< l R R R R| R R4R]$R$L]LdRlRR $RRRDRR< W W W WPWWW0XWlWWWDWWWd|WWW RRRR YYYY  TTTT RRRl R R R| R RR $RRRDRRt [ [| [@[d[[4[[D[[([[dp[[[p V V V| VVV$lVV44VdtVVDVV]L ] ] ] ]| ]],H]] ] 4]x]]4]]D](D](]P \ \| \\`\L\\4\\\\\\(\\d\\RR VWVWVWVWZ Z\ ZPZZ,HZZZZ HZxZ,LZZ4hZZ(,Z(Z@`ZZ@ p [x [@[[ d[L[P[[4[[[([ h Rx R R $RLRRR \ ]| ] ]L]]]] ` Y| Y YLYYYY W , R, t W| WW RLpWWW| R\RRR x V VLPVVV] ] , ]L ]],H]] ]] 4]x]4L] ]4]]](D](] 0 YL YYY Y$8YLY Y4YY(Y X R H XL XXXR X$0XX4<XX4HXX\XXL P \ \ \\ @ VVV VVXXYY RRxR XX|X T|T RRX`a`tRR TT\|TTRRVW|VWVWVW$ D,- dVd``4`$`T```<l``LP`X`HX`X`(<``<!`0!"`""V@#H#`H#P#VP#d#`x##`##`<$@$`T$t$`$$` dWdc4c$ cH T ccTccc<ccxc(c<chct c !c0!"c@#d#cx##c##c$$c<$$c$$c ddRTTpRp<<@R@"""R"@#@#P#RP#$<Tp<"(#@#P#x##$fdf4ff$fxfHfffffff$fd fLp^pH Z $P< np$7j bP< ~:z 4cX< : c`<;L c0<>t d0<DAT LdX<B d<B\ d0< H e<2I$J lf<%f$! dk< 2?`(O^ o(@pX q<, qP<.pC r<0p#,5 B<2pX,h BX<4+p, ' DC<69p08UD0;Mo;<]H=R N    #)8&G@(PWL[t`Th\q %z$*"(#(' "#$%&'()*+,.02468+ +8+ +@+H+0++(+P++X+`+p+h++ ++ x+%+9:1:Mbipy~$ bionic/libc/stdlib/strtod.cBfreebigint_invalid_valuefreelist_mutexfreelistBallocd2bmultmultaddpow5multp05.3459p5s_mutexp5slshifttensbigtenstinytens$LC0$LC1$LC2$LC3$LC6$LC10$LC7$LC11$LC12$LC9$LC5$LC8$LC13$LC4$LC17$LC18$LC20$LC19$LC22$LC23$LC24$LC16$LC21$LC14$LC15_gp_disppthread_mutex_lockpthread_mutex_unlockmallocmemcpyfreedtoafreestrtod_ctype__tolower_tab_strncasecmp__errno__dtoastrcpy @`WY ^ 444!3%34:4A4H4O4T4_4l4s4z4444444444#4.4;4W4f444P4444441 5 90F0L4}40000000400"000>0V0d0r0{333030334V4000000!0*030<0E0N0W0`0i0r0{04000'00090B0K0T0]0f0m4uy04000000 0 ' # 39 = 3S 3a 0t 0} 0 0 0 0 0 0 0 0 0 0  3 3 0   3" 3D 4P T X 0j 0x 0 0 0 0 0 0 0 0 0  3 4c 4, 46 4A E I 0] 0l 0| 0 0 0 0 0 4 0 0 4 0 0 0 4' 05 0C 0Q 0` 0p 0 0 0 0 4 0 0 0 4 0 4 0/0=0K0[0k0z000404444444 4337MQ3p0u300033300,050>0G0P0Y0b0k0tx330000330000 0 313F0O0Z^3t300033000003"3483J3S0\0j0s0|033330+/EI_c3t3000000330$024b4x44##004 0%40054D4O0c4n000004040004480G0V0i4t0y404404000040 00+0:0H0\4g0l4w0004#4#4#4#4#4#4#33,050C0L0U0^0g0p0y00#330##33000##)#-#>#B#R#V3l3u0~0000#330000000 000&0/080A#E3W3`0n0w0#330000###303'00090B0K0T0d#h3x03000000#30300 000&06#:#P#T#]0f0o0}0#33#330000# 33(010:0C0L0U0^0g0p0y0000#33000#33 000-0=#A3Q0`3i0r0{0000#3030#3300000*#.3R4_*d4q(v4+,4&4$4%4 ) 4# 4; 4 ;6 #RR( +,+8 S@(L *T*` T4 (p(RR, S8(D *H*l T( (t( U ++RR ,@ +D+RR, +0+h xRR, +4+  V$ ( < @ RR XRR< +D+ S&, (( **  TH S Tl S T T&4 SX 'T'\ d U  d && T   ,,,D T@ (L(RR, +0+l p  S (,(8 *@*L T (T(  RR\ Z [ \ 55 \ 6$68 7@7D7< \8 8@8p $$ $$  $,$T ]l %x% ]X `x ++  ` 9p9h :x:l ;;t <<| == V     @       8 D d p        ( ,  < @  T X  ; ; : :l Sp( ** T( S( ** T(4 Sh (8(P *X*h T (p( S0 (( ** T ((D ;H;X >`>\ :h:l: ??  8 @@@< ;H;L;@ @h@d ;p;t;, 8 :: A(A BB ]P ]h 7p7 BB $($T ]X )d) 777 $$H $T$ ] %%RR  C$C D4D( E<E0 FPFH$ D  ++ $$4 %8%l ;p; GG H| HH HH IIT $\$ GG S8 (| (( ** Tl ((    0   , 8  t x ++ + +  < S (@ (X *` *p T$ (x ( ++    II  D $P$h %p%  ( S  (,(P *X* T ((  V< Dh V  V   V8 D   U< L\ +`+h JpJxJ|    BB, 4| KK $$ :: ; ;$ G0 G     V   $H!$! G!G! :!:(" 0" @" HP"H" L"L" "" +"+" _@# M" ML#M$ T$ ($$(0$ +8$+<$ @$ . 4.8X.\x.|... .4.8.# 8\|8#     $ + / 6 : IMUYimtx(,:>TX_cjn}$(7;BFMQX\cgnry} &*15<@GKRV]ahlsw  $37KOVZaetx!(,;?FJQU\`gkrv}!%,07;JNUY`dkovz %)04;?NRY]lpw{  !(,37>BQUdhosz~    . 2 9 = L P W [ b f m q x |                         " & - 1 @ D K O V Z a e l p w {                             $ ( / 3 : > E I P T [ _ f j q u |                            & * 1 5 < @ O S Z ^ e i x |                           " & - 1 8 < C G N R Y ] d h o s z ~                     $(/3:>EIPT[_fjqu &*15DHOSZ^eipt{ "&-18<CGNRY]dhosz~ $(/3:>MQY]mqx|  /3:>EIPT[_fjy}!(,37>BIMTX_cjnuy #*.59@DKOVZaelpw{  /3:>EIPT[_fjqu| "&-18<CGNRY]dhosz~  '+26=AHLSW^bimtx%)04;?FJQU\`gkrv} "&-18<CGNRY]dhosz~  '+26=AHLSW^bimtx !%,07;BFMQX\cgnry} &*15DHOSZ^eipt{  $37>BIMTX_cjnuy%)04;?FJQU\`gkrv}   '+26=AHLSW^bim|      ! % , 0 7 ; B F M Q X \ c g n r y }                        !! !!!!"!)!-!4!8!?!C!R!V!]!a!h!l!s!w!~!!!!!!!!!!!!!!!!!!!!!!!" """" "$"+"/"6":"A"E"L"P"W"["b"f"m"q"x"|"""""""""""""""""""""""######%#)#0#4#;#?#F#J#Y#]#d#h#o#s#z#~#####################$$$$$$$$($/$3$:$>$E$I$P$T$[$_$f$j$q$u$|$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%!%%%,%0%7%;%B%F%M%Q%X%\%c%g%n%r%y%}%%%%%%%%%%%%%%%%%%%%%%%%&&&&&&&*&1&5&<&@&G&K&R&V&]&a&h&l&s&w&~&&&&&&&&&&&&&&&&&&&&&& '''#'/'3'A'E'S'W'e'i'w'{''''''''''''''''((((#(1(5(A(E(S(W(c(g(s(w((((((((((((((())))%)))7);)I)M)[)_)m)q))))))))))))))))))))* **** *$*+*/*6*:*A*E*L*P*_*c*j*n*u*y*************************++++++%+)+0+4+;+?+F+J+Q+U+\+`+g+k+r+v+}++++++++++++++++++++++++ , ,,,,#,*,.,5,9,@,D,K,O,V,Z,a,e,l,p,w,{,,,,,,,,,,,,,,,,,,,,,,,----!-%-,-0-7-;-B-F-M-Q-X-\-c-g-n-r-y-}----------------------- ....#.'...2.9.=.D.H.O.S.Z.^.e.i.p.t.{.......................// ////!/(/,/3/7/>/B/I/M/T/X/_/c/j/n/u/y/////////////////////////000000%0)00040;0?0F0J0Q0U0d0h0o0s0z0~0000000000000000000000001 1 1111#1*1.15191@1D1K1O1V1Z1a1e1l1p1w1{111111111111111111111112222!2%24282?2C2R2V2e2i2p2t2{2222222222222222222222233333%3)30343;3?3F3J3Q3U3\3`3g3k3r3v3}33333333333333333333333344 4444"4&45494@4D4K4O4^4b4i4m4t4x4444444444444444444444444555555$5(5/535:5>5E5I5P5T5[5_5f5j5q5u5|5555555555555555555555566 6666"6)6-64686?6C6J6N6U6Y6`6d6k6o6~66666666666666666666677 7777!7(7,73777>7B7I7M7T7X7_7c7r7v7}77777777777777777777777788 8888"8&85898@8D8K8O8V8Z8i8m8t8x8888888888888888888889 99999&9*91959<9@9G9K9R9V9]9a9h9l9{9999999999999999999999999: ::::(:,:3:7:>:B:I:M:T:X:_:c:j:n:u:y:::::::::::::::::::::::;; ;;;;";&;-;1;8;<;C;G;N;R;Y;];d;h;o;s;z;~;;;;;;;;;;;;;;;;;;;;;;;< <<<< <'<+<2<6<=<A<P<T<[<_<n<r<~<<<<<<<<<<<<<<<<<<<<======$=(=/=3=:=>=E=I=P=T=[=_=f=j=q=u=|=======================>> >>>&>*>1>5><>@>G>K>R>V>]>a>p>t>{>>>>>>>>>>>>>>>>>>>>>>>?? ???%?)?0?4?;???F?J?Q?U?\?`?g?k?r?v?????????????????????@@@@@@$@(@/@3@:@>@E@I@P@T@[@_@f@j@q@u@|@@@@@@@@@@@@@@@@@@@@@@@AA AAAA"A)A-A4A8AGAKARAVA]AaAhAlAsAwA~AAAAAAAAAAAAAAAAAAAAAAAB BBBB(B,B3B7B>BBBIBMBTBXBgBkBrBvBBBBBBBBBBBBBBBBBBBCCCCC"C)C-C4C8C?CCCRCVC]CaChClCsCwCCCCCCCCCCCCCC#C#C#C# D#D#'D#+D#2D#6D#=D#AD#HD#LD#SD#WD#^D#bD#iD#mD#tD#xD#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#D#E#E#E#E#E#E#$E#(E#/E#3E#:E#>E#ME#QE#XE#\E#cE#gE#nE#rE#yE#}E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#E#F#F# F#F#F#F#"F#)F#-F#4F#8F#?F#CF#JF#NF#]F#aF#iF#mF#tF#xF#F#F#F#F#F#F#F#F#F#F#F#F#F#F#F#F#F#F#F#F#F#G# G#G#G#G#%G#)G#2G#6G#GG#KG#RG#VG#]G#aG#hG#lG#sG#wG#~G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#G#H#H# H#H#H#H##H#'H#.H#2H#AH#EH#NH#RH#YH#]H#fH#jH#qH#uH#~H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#H#I#I# I#I#I#I##I#'I#.I#2I#9I#=I#DI#HI#OI#SI#ZI#^I#eI#iI#pI#tI#{I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#I#J#J# J#J#J#J#!J#(J#,J#3J#7J#>J#BJ#IJ#MJ#TJ#XJ#_J#cJ#jJ#nJ#uJ#yJ#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#J#K#K#K#K#K#K#%K#)K#0K#4K#;K#?K#FK#JK#QK#UK#\K#`K#oK#sK#zK#~K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#K#L# L#L#L#L# L#'L#+L#2L#6L#=L#AL#HL#LL#SL#WL#^L#bL#iL#mL#tL#xL#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#L#M#M#M#M#M#M#$M#(M#/M#3M#:M#>M#EM#IM#PM#TM#[M#_M#fM#jM#qM#uM#|M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#M#N#N# N#N#N#N#"N#)N#-N#4N#8N#?N#CN#JN#NN#UN#YN#`N#dN#kN#oN#vN#zN#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#O#O# O#O#O#O##O#'O#.O#2O#9O#=O#DO#HO#OO#SO#ZO#^O#eO#iO#pO#tO#{O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#O#P# P#P#P#P# P#$P#+P#/P#6P#:P#AP#EP#LP#PP#WP#[P#jP#nP#uP#yP#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P#Q#Q#Q#Q#Q#Q#%Q#)Q#0Q#4Q#CQ#GQ#NQ#RQ#YQ#]Q#dQ#hQ#oQ#sQ#zQ#~Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#Q#R# R#R#R#R# R#'R#+R#2R#6R#=R#AR#HR#LR#SR#WR#^R#bR#iR#mR#tR#xR#R#R#R#R#R#R#R#R#R#R#R#R#R#R#R#R#R#R#R#R#R#R#S#S# S#S#S#S#!S#%S#,S#0S#7S#;S#BS#FS#MS#QS#XS#\S#cS#gS#nS#rS#yS#}S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#S#T# T#T#T#T#T#&T#*T#1T#5T#Z#EZ#IZ#PZ#TZ#[Z#_Z#fZ#jZ#qZ#uZ#|Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#Z#[#[# [#[#[#[#"[#)[#-[#4[#8[#?[#C[#J[#N[#U[#Y[#`[#d[#k[#o[#v[#z[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#[#\# \#\#\#\#\#&\#*\#1\#5\#<\#@\#G\#K\#R\#V\#]\#a\#h\#l\#{\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#]# ]#]#]#]# ]#$]#+]#/]#6]#:]#A]#E]#L]#P]#W]#[]#b]#f]#m]#q]#x]#|]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#]#^#^#^#^#^#^#%^#)^#0^#4^#;^#?^#F^#J^#Q^#U^#\^#`^#g^#k^#r^#v^#}^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#^#_#_# _#_#_#_#"_#&_#-_#1_#@_#D_#R_#V_#d_#h_#v_#z_#_#_#_#_#_#_#_#_#_#_#_#_#_#_#`# `#`#`#*`#.`#<`#@`#N`#R`#``#d`#z`#~`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#a# a# a#a#a#a##a#*a#.a#5a#9a#@a#Da#Ka#Oa#Va#Za#aa#ea#la#pa#wa#{a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#b# b#b#b#b# b#'b#+b#2b#6b#=b#Ab#Hb#Lb#Sb#Wb#^b#bb#ib#mb#tb#xb#b#b#b#b#b#b#b#b#b#b#b#b#b#b#b#b#b#b#b#b#b#b#c#c# c#c#c#c#)c#-c#4c#8c#?c#Cc#Rc#Vc#bc#fc#rc#vc#c#c#c#c#c#c#c#c#c#c#c#c#c#c#c#c#c#d#d# d#d#d#%d#)d#0d#4d#;d#?d#Fd#Jd#Qd#Ud#\d#`d#gd#kd#rd#vd#}d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#d#e#e# e#e#e#e#"e#&e#5e#9e#@e#De#Ke#Oe#Ve#Ze#ae#ee#te#xe#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#e#f#f#f#f#f#f#$f#(f#/f#3f#:f#>f#Ef#If#Pf#Tf#[f#_f#ff#jf#qf#uf#|f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#f#g#g# g#g#g#.g#2g#Ag#Eg#Lg#Pg#Wg#[g#bg#fg#mg#qg#xg#|g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#g#h#h# h#h#h#h#!h#(h#,h#;h#?h#Fh#Jh#Qh#Uh#\h#`h#gh#kh#rh#vh#}h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h#i#i# i#i#i#i#"i#&i#5i#9i#@i#Di#Ki#Oi#^i#bi#ii#mi#ti#xi#i#i#i#i#i#i#i#i#i#i#i#i#i#i#i#i#i#i#i#i#j# j#j#j#j#j#&j#*j#1j#5j#k#Bk#Ik#Mk#Tk#Xk#_k#ck#jk#nk#uk#yk#k#k#k#k#k#k#k#k#k#k#k#k#k#k#k#k#k#k#k#k#k#k#l#l# l#l#l#l#"l#&l#-l#1l#8l#q#Bq#Iq#Mq#Tq#Xq#_q#cq#jq#nq#uq#yq#q#q#q#q#q#q#q#q#q#q#q#q#q#q#q#q#q#q#q#q#q#r# r# r#r#r#r##r#*r#.r#5r#9r#@r#Dr#Kr#Or#Vr#Zr#ar#er#lr#pr#wr#{r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#r#s#s#s#s#s#s#$s#(s#7s#;s#Bs#Fs#Ms#Qs#Xs#\s#cs#gs#ns#rs#ys#}s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#s#t#t# t#t#t#t#"t#)t#-t#4t#8t#?t#Ct#Jt#Nt#Ut#Yt#`t#dt#kt#ot#vt#zt#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#u#u# u#u#u#u##u#'u#.u#2u#9u#=u#Du#Hu#Ou#Su#Zu#^u#eu#iu#pu#tu#{u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#v#v# v#v#v#v#!v#(v#,v#3v#7v#>v#Bv#Iv#Mv#Tv#Xv#_v#cv#jv#nv#uv#yv#v#v#v#v#v#v#v#v#v#v#v#v#v#v#v#v#v#v#v#v#v#v#w#w# w#w#w#w#"w#&w#-w#1w#8w#y#My#Qy#Xy#\y#cy#gy#vy#zy#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#y#z# z#z#z#z#z#&z#*z#9z#=z#Dz#Hz#Oz#Sz#Zz#^z#ez#iz#pz#tz#{z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#z#{# {#{#{#{#!{#({#,{#3{#7{#>{#B{#I{#M{#T{#X{#_{#c{#j{#n{#u{#y{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#{#|#|# |#|#|#|#"|#&|#-|#1|#8|#<|#C|#G|#N|#R|#Y|#]|#d|#h|#o|#s|#z|#~|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#|#}# }#}#}#}# }#'}#+}#2}#6}#=}#A}#H}#L}#S}#W}#^}#b}#i}#m}#t}#x}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#~#~# ~#~#~#~#"~#)~#-~#4~#8~#?~#C~#J~#N~#U~#Y~#`~#d~#k~#o~#v~#z~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~### ######'#.#2#9#=#D#H#O#S#Z#^#e#i#p#t#############################%#)#0#4#;#?#F#J#Q#U#\#`#g#k#r#v#}############ǀ#ˀ#Ҁ#ր#݀######## # ######*#.#5#9#@#D#K#O#V#Z#a#e#t#x##############Ł#́#Ё#ׁ#ہ#############,#0#?#C#J#N#U#Y#`#d#k#o#v#z#############Â#ǂ#΂#҂#ق#݂####### ######'#.#2#9#=#D#H#O#S#Z#^#e#i#p#t#{##############ȃ#̃#Ӄ#׃#ރ####### ####!#0#4#;#?#F#J#Q#U#\#`#g#k#r#v#}#############Ä#ʄ#΄#Մ#ل####### # ######*#.#5#9#@#D#K#O#V#Z#a#e#l#p#w#{#############ą#ȅ#ׅ#ۅ#############$#(#/#3#:#>#E#I#P#T#[#_#f#j#q#u#|############Ɔ#ʆ#ц#Ն#܆######### ####"#)#-#4#8#?#C#J#N#]#a#h#l#s#w#~#############ć#ˇ#χ#և#ڇ######### ######'#6#:#A#E#L#P#W#[#b#f#m#q#x#|#############ň#Ɉ#Ј#Ԉ#ۈ#߈###########%#)#0#4#;#?#N#R#Y#]#d#h#o#s#z#~#############lj#ˉ#҉#։#݉########### #'#+#2#6#=#A#H#L#S#W#^#b#i#m#t#x##############Ŋ#̊#Њ#׊#ۊ####### ####!#%#,#0#7#;#B#F#M#Q#X#\#c#g#n#r#y#}###########Ë#Nj#΋#ҋ#ً#݋######## #####&#*#1#5#<#@#G#K#R#V#]#a#h#l#s#w#############Ȍ#̌#ӌ#׌#ތ######## #### #$#3#7#>#B#I#M#T#X#_#c#j#n#u#y###########Ǎ#ˍ#ڍ#ލ#########!#%#,#0#7#;#J#N#U#Y#`#d#k#o#v#z###########Ȏ#̎#ӎ#׎#ގ####### ####!#(#,#3#7#>#B#I#M#T#X#_#c#j#n#u#y##############Ə#͏#я#؏#܏#############%#)#0#4#;#?#F#J#Q#U#\#`#g#k#r#v#}#############Ð#ʐ#ΐ#Ր#ِ######### #####*#.#5#9#@#D#K#O#V#Z#a#e#l#p#w#{############ő#̑#Б#ב#ۑ#############$#(#/#3#:#>#E#I#X#\#c#g#v#z###########Ȓ#̒#Ӓ#ג#ޒ######## #### #$#3#7#>#B#I#M#T#X#_#c#j#n#u#y############Ó#ʓ#Γ#Փ#ٓ####### # ######2#6#=#A#H#L#S#W#^#b#i#m#t#x############”#є#Ք#ܔ####### #####&#*#1#5#<#@#O#S#Z#^#e#i#x#|#############͕#ѕ#ؕ#ܕ####### ####"#&#5#9#@#D#K#O#V#Z#i#m#t#x############–#ɖ#͖#Ԗ#ؖ#ߖ######## ####!#%#,#0#7#;#J#N#U#Y#`#d#k#o#~############ȗ#̗#ӗ#ח#ޗ####### ####!#(#,#3#7#F#J#Y#]#d#h#o#s#z#~###########̘#И#ט#ۘ#############$#(#/#3#:#>#E#I#P#T#[#_#f#j#q#u#|#############™#ə#͙#ԙ#ؙ#ߙ######## ####)#-#4#8#?#C#J#N#]#a#h#l#s#w###########Ś#ɚ#К#Ԛ#ۚ#ߚ###########%#)#0#4#  (08@HPX# (,048<@DPTX\hlpt  $048<@DHLPT`dhlptx|(,048<HLPTX\hlptx|(,04@DHLPTX\hlptx|  $(,048<@DPTX\`dptx|  $(,04@DHLPT`dhlptx|  $(,04@#D#H#L#P#T#X#\#`#d#h#l#p#t#x#|################################ ##### #$#0#4#8#<#@#D#H#L#P#T#X#\#`#d#p#t#x#|########################## ##### #$#(#,#0#4#@#D#H#L#X#\#`#d#p#t#x#|######################### # # # # # # #$ #0 #4 #8 #< #@ #D #H #L #X #\ #` #d #h #l #p #t # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #$ #( #, #0 #4 #@ #D #H #L #X #\ #` #d #p #t #x #| # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #$ #0 #4 #8 #< #H #L #P #T #` #d #h #l #x  |                  # #strtoimax.o/ 1331265333 1002 1002 100644 8584 ` ELFP4(!X% RU$ > $ > : ; I$ > .? : ; ' I : ; I.? : ; ' I@ : ; I 4: ; I 4: ; I 1RUX Y 1 I&I4: ; I? < CintW6^@N*<:*7Sw)c)ak)ck))c)$ +! +J O+)s s- acc. . c/)e neg0) any0) #0)8 8 289Ei:+ bionic/libc/stdlibbionic/libc/includebionic/libc/arch-mips/include/machinestrtoimax.cctype.h_types.hstdint.hinttypes.h+< A`*p*HR ( $"$( $Q $!0<&"& K,`>.2!hL0Y0W$7$ #?*2@& T!!PLHD@<840X'&`xLpx^pY Z  npd/j  ~$z ` p D  D p@   p  @!p  H!p.( X!0p0VT0 o  U    )2$ <EMbionic/libc/stdlib/strtoimax.c__moddi3__divdi3strtoimax_gp_disp_ctype___errno !%3:AHOTahov}    $ )3 8B O ^ cm z      <   t t  D           ! % , 0 7 ; J N U Y ` d s w ~                      % ) 5 9 E I U Y e i u y                    ! - 1 = A M Q ] a m q }                     ! - 1 = A M Q e i p t {                            % ) 8 < C G N R Y ] d h o s z ~              strtol.o/ 1331265333 1002 1002 100644 6264 ` ELF P4(!H% RU$ > $ > $ >  I.? : ; ' I : ; I.? : ; ' I@ : ; I 4: ; I 4: ; I 1RUX Y 1&I4: ; I? < int@`N3)c)k)ck))c),@a ,! ,J ,)s s. acc/a /a c0)- neg1) any1) 91)! k 8s9E:M] bionic/libc/stdlibbionic/libc/includestrtol.cctype.hstdlib.h,< xLpx^pLZ h np6Qj ( ~z 08 p4D hxD xp4 p  0p  8p- ( H0p0U 30 o    x=    $-5bionic/libc/stdlib/strtol.cstrtol_gp_disp_ctype___errno !%3:AHOV]dkry      ' 4 C HR _ n }   j < 4   ,        ! % , 0 7 ; J N U Y ` d s w ~                          - 1 8 < C G N R Y ] d h o s z ~                         ! %        strtoll.o/ 1331265333 1002 1002 100644 3616 ` ELFP4(!% RU$ > $ > $ >  I.? : ; ' I@ : ; I&I 4: ; I? < 6sint(a AS...)& 8 9E S:t^ bionic/libc/stdlibbionic/libc/includestrtoll.cctype.hstdlib.h. <'!  |   |   T U Vstrtolllong long intnptrunsigned intstrtollunsigned charbionic/libc/stdlib/strtoll.c_toupper_tab_long unsigned int/u/raghu/ics_feb29long long unsigned intbaseGNU C 4.4.3_tolower_tab_long intdoubleshort unsigned intsigned charfloat_ctype_short intcharendptrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strtoll.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx~^pZ  npxj  ~z  p    p9 0p p;  p[ p0k0zo   \ 9    &/bionic/libc/stdlib/strtoll.cstrtoll_gp_dispstrtoimax !%3:AHOV]dkry     k         & *    strtoul.o/ 1331265333 1002 1002 100644 5728 ` ELF P4(!H% RU$ > $ > $ >  I.? : ; ' I : ; I.? : ; ' I@ : ; I 4: ; I 4: ; I 4: ; I 1RUX Y 1&I4: ; I? < int~$D2m)c)k)ck))c)WBh` t+! +J y+)s s- acc.h .h c/) neg0) any0)Y 0) O8_9E':1^ bionic/libc/stdlibbionic/libc/includestrtoul.cctype.hstdlib.h+< xLpx^pYZ P np:5j  ~p`z ( pD 0D @pX Hp p  p ( 00p0@ 50u o    h?   ` &/7bionic/libc/stdlib/strtoul.cstrtoul_gp_disp_ctype___errno !%3:AHOV]dkry      ' 4 C H[ x } k < ( h        ! % , 0 7 ; J N U Y ` d s w ~                          % ) 0 4 ; ? F J Y ] d h o s        strtoull.o/ 1331265333 1002 1002 100644 3620 ` ELFP4(!% RU$ > $ > $ >  I.? : ; ' I@ : ; I&I 4: ; I? < .lint ZCZ. ..)& 8 9E L:u_ bionic/libc/stdlibbionic/libc/includestrtoull.cctype.hstdlib.h. <'!  |   |   T U Vstrtoulllong long intnptrunsigned intunsigned charbionic/libc/stdlib/strtoull.c_toupper_tab_long unsigned int/u/raghu/ics_feb29long long unsigned intbaseGNU C 4.4.3_tolower_tab_long intdoubleshort unsigned intsigned charfloat_ctype_short intstrtoullcharendptrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strtoull.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx~^pZ  npyj  ~z  p    p9 0p p<  p\ p0l0}o   ` ;    (1bionic/libc/stdlib/strtoull.cstrtoull_gp_dispstrtoumax !%3:AHOV]dkry     l         & *    strtoumax.o/ 1331265333 1002 1002 100644 7168 ` ELFHP4(!X% RU$ > $ > : ; I$ > .? : ; ' I : ; I.? : ; ' I@ : ; I 4: ; I 4: ; I 4: ; I 1RUX Y 1 I&I4: ; I? < Fintn"8e|-?h8Z9)c)k)ck))c)A +! +J R+)s s- acc. .x c/) neg0) any0) K0) \`8R9E: bionic/libc/stdlibbionic/libc/includebionic/libc/arch-mips/include/machinestrtoumax.cctype.h_types.hstdint.hinttypes.h+< xLpx^ph Z x nprj  ~z @ pD @D Pp$ ' X`pK  pk  p ( 0p0 W0  o,p   W    *4 >GObionic/libc/stdlib/strtoumax.c__udivdi3__umoddi3strtoumax_gp_disp_ctype___errno !%3:AHOV[hov}    $ )3 8B O ^ cm z     <   <          ! % , 0 7 ; J N U Y ` d s w ~                       $ 0 4 @ D P T ` d x |                     ( , 8 < H L X \ h l                                  tolower_.o/ 1331265333 1002 1002 100644 4460 ` ELF@P4($!% RU$ > $ > $ >  I&I.? : ; ' I@ : ; I 4: ; I? < 4: ; I?  I !I/\.int!zJE8c4E 8 97 <: 7 }  lS bionic/libc/stdlibbionic/libc/includetolower_.cctype.h5u<'!,`!$@ !B  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ |  8 |  8 T,R00R08T<tolower_tolower_tab__C_tolower_88long long intshort unsigned intunsigned intunsigned char_toupper_tab_long unsigned intbionic/libc/stdlib/tolower_.clong long unsigned int/u/raghu/ics_feb29GNU C 4.4.3_tolower_tab_long intdouble_C_tolower_signed chartolowerfloat_ctype_short intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.tolower.rodata._C_tolower_.rel.data.rel._tolower_tab_.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 ">xLpx^pZ " np5pj " ~8z "  "p  "  "p(4 @"p\@ D"p  L"p \"#p0 .07oG # J    8 '0>bionic/libc/stdlib/tolower_.ctolower_gp_disp_tolower_tab__C_tolower_ !%,3:AOV]dkry  `           ! %    toupper_.o/ 1331265333 1002 1002 100644 4460 ` ELF@P4($!% RU$ > $ > $ >  I&I.? : ; ' I@ : ; I 4: ; I? < 4: ; I?  I !I/{Iint\7sE8c5E 8 97 ): 7 }  lS bionic/libc/stdlibbionic/libc/includetoupper_.cctype.h6u<'!,`!$@ !B  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ |  8 |  8 T,R00R08T<toupper_toupper_tab__C_toupper_88long long intunsigned intunsigned char_toupper_tab_long unsigned int/u/raghu/ics_feb29long long unsigned inttoupperGNU C 4.4.3_tolower_tab_long int_C_toupper_bionic/libc/stdlib/toupper_.cdoubleshort unsigned intsigned charfloat_ctype_short intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.toupper.rodata._C_toupper_.rel.data.rel._toupper_tab_.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 ">xLpx^pZ " np5pj " ~8z "  "p  "  "p(4 @"p\@ D"p  L"p \"#p0 .07oG # J    8 '0>bionic/libc/stdlib/toupper_.ctoupper_gp_disp_toupper_tab__C_toupper_ !%,3:AOV]dkry  `           ! %    wchar.o/ 1331265333 1002 1002 100644 40420 ` ELFSP4(}00 0     ((((% RU$ > $ >   $ > : ; I: ;I  I  : ;  : ; I8 : ; I8 ' II&II!I/  : ;  : ;  : ; ( .? : ; ' I : ; I.: ;' I : ;I.? : ; ' I@ : ; I : ; I1X Y 1: ; I 1X Y !: ; I ": ;I #.? : ; ' I@$: ;I%4: ;I &4: ;I': ;I(4: ;I)4: ; I*4: ; I+&I,1RUX Y -.? : ; ' I@ ./4: ; I 04: ; I1!24: ; I? < 34: ;I? < 5 8 int5P:e(}|LRCE% a CN W X# 4YE# 0 Tw) _px# _ryE# _wzE# K{7# |7# _bf}# B~E# # j9# oY#$ gy#( ]#, #0 _up#8 _urE#< m#@ S#C _lb#D 9E#L 2#P E9 ) EYE ? yE _ EE  00Yftm,- .E# y/E# 0E# g1E# 2E# 3E# 4E# $5E# +6E# I8a#$ 9#(b 5E 6 Z 6E#& 6 8B* q    ^ GfE7cfEKkESckEzpEocpEzEczEAEcEEcEtEcEEcEDEcEE3cEEOcEEkcEEcE4E_cE_p  Mc#ET PE8wcq (q-u QE8^wcr)7 (rI RE8wcsRS (se SE wctT TE8wcu{o (u UE8Gwcv (v VE8wcw (w WE8wcx (x\ XE8wcy (y YE8GwczH (z d ZE8wc{q ({) [E wc}}~ <`) `- 7 I 3$ E S= e oV  4o  4X  X|  |   `E !sT!uEU cE0 ps0 T 6  dz sTnUpsz V  e\ pwc TsnVpsz W i l8 wcO 0aa m8T wck 0}B r sTwcUpsz V E "c1TJ E "wcGT# 6 $,67% 8F &nn>E`F  6    'ws1, ~'ws2,    h $X' $`' $'E   a3 $X" $`" $"Er op $X $` )# < 'dst \'src  z'len 'ps z (s (s2   # 86'dst'src 'len&# f9dst YsrcЦwlenКpsz )sҙ*s2ә # 8dst srcߙlenߚ60 zT'wcs I$:\$ o$T Z+tm< nwcs iwc, ~ hwcsQ ^Uwcs-  bX aXs%n _Estr dsw ] ws nEs \Gs# kE@sk k .# OE@sZ<Z O.#  qE<bsT nTT argT#R oE<`sNN  argN  pE(I ' argIE # ETc ` ./Lb0cE# jE< Cs> n> > ./L@0AE# ED 3  ./L506E# NE@- s(M ( ` ./L*0+E123%E2829  &72S: 7 bionic/libc/stdlibbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/syswchar.cctype.hstdio.hstdarg.hstddef.hposix_types.htypes.htime.hwchar.hstdlib.h# w}Jyu qmieaqNtyt txyyyyytKKtKItt( JKsJIKM    (KH􃄃HuIK (KH􃄃HuIK  J~JJ~<      uIKH uIKH uH uH KK tOIKEK >xKENK 3xKEK (xKEK !<'!$0! b0!<'!$0! b0!<'!$0!  b0!$ B,<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! b0!<'!$0! Db0!<'! ,`!8(%!(!@$0!(GD0 $0͍! b1$0Œ!C83 $E 8,$0!PI "1$ ,$0C!y1$0I!8(0 $0!h1$0!Fy"3$0!Hj(1 $08! 1$`4X|<!$+alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit<'!!+! $<'!,`!$@ !B<'!,`!$@ !B$$!*<'!',($ !&! $ !(@ @1&3&,!($ 0',! ($ 0'<'! <'! <'! <'! <'!',($ !!!(!  !@#Q&`! `!(  !0,!0Q!($ 0'<'!'$!8 $' '<'!',($ !!!(!  !@#Q&`! `!(  !0,!0Q!($ 0'<'!'$!8 $' '<'! <'!& &<'!b @&\&$ `\T0j%bTf&  T$l*8h $ T$<'!& &<'!& &<'!b @$ %  <'! @!$ %d  <'! <'! <'! <'!'( ,z$C '$<'!'( ,z$C '$<'!' z$C '$<'!' z$C '$<'!!!0T$ !(@<'!'$!,',04T$!(` !0@$('<'!'$4'4 !8@$('<'!'$,',04 !(@$('<'!'$0'04 !0@$(' (08@HPX`h |   8 8 8 8 8 8 8 8 8 8     \ 8 8    P0T     P0T8P D P0T8P D     X X   @P D@P D<P D<P D (TP(D<P(DDP(D@P(D |   $8 48 D8 T d8 t8 8 8 8 8 8     \ $8 48 D T d tP0T     P0T8P D P0T88P D P ` p   X X   @P D@P D <P D8<P D P(`TP(Dx<P(DDP(D@P(D T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T T0U08T LTL`W`pTp\TST[TTi T 4X4hTh|V|TZT_T ,U PUT\U T,R00R08T T,R00R08T0 <T<pbb8taa T U T U V T U V T U0 @T@c <U<b HVHT`X` HW8 ,T $U$8$ ,V0 @T@c <U<b HVHT`X` HW,xa8 ,T $U$8$ ,V T U V W T U TLXT T U T U T,S,4T4LSLXT T U T U V T@ (T (U@ (T (U< $T $U $V $W< $T $U $V T(R U (VT( T HS<( 0T 0U 0VD( 8T@( 4T 4Uq9btowciswalnumiswalpha^iswcntrliswdigitiswgraphiswlowerGiswprintiswpunctiswspaceiswupperGiswxdigitiswctype fwide mbsinit; mbrlen mbrtowc towlower towupperT wcrtomb wctob wcwidth wctypeK wcswcs wcstoul wcstol3 wcstodp wcsrtombs wcstombs6mbsrtowcsmbstowcswcsftimebungetwcputwcharputwcfputwcUgetwcharmgetwcfputwsfgetwsfgetwcGswscanffwscanfvswprintfvfwprintf`vwprintfwscanfswprintfCwprintffwprintf888 8888888\8888XX@@<<(T<D@ $`(D888 8888888\8888XX@@<<(T<D@GNU C 4.4.3wprintfiswlowerformattm_ydaypropertyunsigned int_lbfsize_flagswchar_tdummyendptrtm_mday_readmodeiscntrl_cookieWC_TYPE_MAXfwscanfWC_TYPE_LOWERtm_monfpos_tisspacecharclassfloatwcswcsbaseresultgetwclong long unsigned int__sFILEbionic/libc/stdlib/wchar.c__isthreaded_offsetmaxsizewcrtombwcwidthvfwprintfiswspace__gnuc_va_listispunctsize_tisprintiswcntrlWC_TYPE_INVALIDfwidetouppertimptriswdigitwscanfiswpunctisgraphWC_TYPE_UPPERchariswprintWC_TYPE_CNTRLswscanf_exttm_yearwctypevswprintfWC_TYPE_DIGIT/u/raghu/ics_feb29isalpha_toupper_tab_towupper_closeWC_TYPE_SPACEmbsrtowcswcstoulmbstowcsva_listlong long intiswgraph_base_fileisalnumswprintffgetwc_tolower_tab_fgetwsisblankWC_TYPE_PUNCTWC_TYPE_PRINTWC_TYPE_XDIGIT__kernel_off_t__sputcungetwcisupperargsfputwcnptr_writeiswxdigitfputwsiswalphaputwcbtowcvwprintfWC_TYPE_GRAPHmbrtowciswctypembsinit__sFshort intwcsrtombslong intmbrleniswuppertolowerWC_TYPE_ALPHAputwchargetwchariswalnumwcstombsmbstate_twcsftime_blksizeWC_TYPE_ALNUMlong unsigned intwint_ttowlowerwcstodtm_minwcstoltm_zoneunsigned charWC_TYPE_BLANKfwprintf__sbufwctobtm_wdaytm_hour_ctype_signed charoff_tshort unsigned inttm_secisxdigit__builtin_va_listpropertiestm_isdst_sizedoubleislowertm_gmtoff_nbufFILEwctype_t_seek_ubufstreamGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.btowc.rel.text.iswalnum.rel.text.iswalpha.rel.text.iswcntrl.text.iswdigit.rel.text.iswgraph.rel.text.iswlower.rel.text.iswprint.rel.text.iswpunct.rel.text.iswspace.rel.text.iswupper.rel.text.iswxdigit.rel.text.iswctype.rel.rodata.iswctype.text.fwide.text.mbsinit.text.mbrlen.rodata.str1.4.rel.text.mbrtowc.rel.text.towlower.rel.text.towupper.text.wcrtomb.text.wctob.text.wcwidth.rel.text.wctype.rel.text.wcswcs.rel.text.wcstoul.rel.text.wcstol.rel.text.wcstod.rel.text.wcsrtombs.rel.text.wcstombs.rel.text.mbsrtowcs.rel.text.mbstowcs.rel.text.wcsftime.rel.text.ungetwc.rel.text.putwchar.rel.text.putwc.rel.text.fputwc.rel.text.getwchar.rel.text.getwc.rel.text.fputws.rel.text.fgetws.rel.text.fgetwc.rel.text.swscanf.rel.text.fwscanf.rel.text.vswprintf.rel.text.vfwprintf.rel.text.vwprintf.rel.text.wscanf.rel.text.swprintf.rel.text.wprintf.rel.text.fwprintf.rel.data.rel.ro.local.properties.3212.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 ds~>Lp^pL 9Z tX ~ np;j L~ z$$8 ܃~%8 ~8%8 ~p% |%8 $~%8 <~%8 T~ $&8 l~\&8 ~1&8- ~D&8@ ~!X'T ̄p~#k(4g <h~%|) ))2)p)\ ~+)8 ą~- *8 ܅~/X*p*x** (~4' +# ~688+4 4~8JP+F L~:[h+W d~<l+h | ~>,8| ~@P, ~B,8 Ԇ~D - ~F8- ~HT- 0~J- L~L- d~N.X |8~P&h.X" (~R6.2 ܇~TG.C ~VX.T ~Xi/@e $~Z{H/@w <~\/< T~^/< l~`0( ~b(0T ~d|0< Ĉ~f0D ܈~h0@ ~j<14  h~l8pp14 t ~nI,5E ~pWp8s S $ ~rfp[Cub ~tzpEv ~vpxG P~xp00Iz0NoNNgP K p   !#%'()*+-/12344l68:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz,*{|1 78@IQ8Z8c l8u8~88888!#'()\+8-8/1234$6+28:B:IP<W^>hov8@B8DFHJLNXPXR TV$X+1@Z9A@\I<^S<`](bfTdm<fvDh~@jbionic/libc/stdlib/wchar.cproperties.3212$LC0btowciswalnum_gp_disp_ctype_iswalphaiswcntrliswdigitiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigitiswctypefwidembsinitmbrlenmbrtowctowlower_tolower_tab_towupper_toupper_tab_wcrtombwctobwcwidthwctypestrcmpwcswcsstrstrwcstoulstrtoulwcstolstrtolwcstodstrtodwcsrtombsmemchrmemcpywcstombsmbsrtowcsmbstowcswcsftimestrftimeungetwcungetcputwchar__isthreaded__sFputc__swbufputwcfputcfputwcgetwchargetc__srgetgetwcfputwsfputsfgetwsfgetsfgetwcfgetcswscanf__errnofwscanfvswprintfvfwprintfvwprintfwscanfswprintfwprintffwprintfK L@O`PQRSTU V@W`XYZ[\] ^@``bcdegi k@m`orstuw y@~` @`  EEE!D%,E3E:EAEOEVE]EdEkErEyEEEEEEEEEEEEE;EIEeEsEEEEEEEE EEEEEEEE$E2E@ENE\EjExEEEEEEEEEEEEEEEEE EEE9EUEqEEEEEEE5EQEmEEE  E  A   E+ / DAM Q `Ek o A  E  EA E-A6:IETXmAvzEAEA E-A6:IETXmAvzEAEA  ) - B F [ _ t x        E   E E E  = EH L  E   A E   A   E! % : AC G V Ea e  E   E   E ! ! A E A E" >1 AM EX #\ #s A A E $ $ E A E A E A E % % E A E A# E. A5 E@ &D &P E[ A` Ek Ar E} ' ' A A A A A E ( ( AA!A1A8EC)G)KA^AmA|AAAE**AAAAE++A$E/A4E?ADEOAdEo,s,AEAE--A-DE..A EAE(/,/AAFEPAWEb0f0oEz1~1EAE22AEAE33AA EAE(4,48EBAIET5X5\AmArE|AE66AEAEAE77AAAEAAE"8&8*A3E=ABELA[AbEm9q9}EAAE::AEAEEE;;AAAE$A*E8EEEP<T<XAaEkAqEEE==AEAEAEEEEEE,E     &Lt:#>Wj{ !#$%&'(/)L*a+r,-./01D2U3f4w56789:;<(=MM NMM NMM NMM NMM NMM NMM NMM NMM NMM NMM $D Nh N N N N N< N` N N N         $ ( , 0 MML FXFMM _MM aMM( >0>< fMM hMM jMM lMM nMM, p\ qMM oMM, p\ qMM sMM vMM xMM z {P |x }MM MM MM z {@ H {L MM z@ L MM MM MM MM MM MM MM MM { MM {$ MM MM MM   $(,0? $?( 4?8 D?H T?X d?ht?x??????????$?(4?8D?HT?Xd?h t?x!?#?$?%?&?'?(?)8?<*P?T+`?d,p?t-?.?/?0?1?2?3?4?5? 6 ?$78?<8P?T9`?d:x?|;?<?= ( 8 H X hx(8HXh x!#$%&'()<*T+d,t-./012345 6$7<8T9d:|;<=      ) - 4 8 ? C R V ] a h l { #*.59HLSW^bqu| ")-48?CJNUY`dko~!!#!'!7!;!B!F!M!Q!`!d!k!o!~####$$$$$$%%%%%%&&)&-&<'@'H'L'\'`'g'k'z'~'''''''''''((((((( (((&(*(9)=)E)I)Y)])d)h)w){)))))))))))))********"*&*6*:*I+M+\+`+o+s+++,,,,----....////%1)10141;1?1F1J1Q1U1d2h2w2{233333344555555 5 56 6(6,6<6@6O6S6b7f7n7r777777777888888 8 8 8 8' 9+ 92 96 9E 9I 9P 9T 9c :g :o :s : : : : : ; ; ; ; ; ; ; ; ; ; < < < < < <- =1 =9 == =M =Q =` =d =   ( 0 8@HPX`hpx !#$%&'()*+,- .(/0081@2H3P4X5`6h7p8x9:;<=--- ---  $ ( , 0 4 8 < @ D HLPTX\`dhlptx|  !!##$$%%&&''(() )**++ ,$,(-,-0.4.8/</@0D0H1L1P2T2X3\3`4d4h5l5p6t6x7|78899::;;<<==index.o/ 1331265333 1002 1002 100644 2968 ` ELFDP4( <% RU$ > $ > .? : ; ' I@ : ; I: ; I  I&IF3int/m4mp"zch")Us skQ bionic/libc/stringbionic/libc/includeindex.cstring.h$Ke!`B$Ce! |  4 |  4 T ,R7index44unsigned intcharindexbionic/libc/string/index.c/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.index.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxs^pZ ` npqoj 0  z4p  8 4  H pT P pr p p  x p p0R0o"2D `  "   4 bionic/libc/string/index.cindex !%39D H \ v^           memccpy.o/ 1331265333 1002 1002 100644 3612 ` ELF<P4( % RU$ > : ; I$ > .? : ; ' I@ : ; I: ; I 4: ; I 4: ; I 4: ; I   I &&I(9int;V%`dstsrc)c)Vn0Rq!Tp"U "#W ch$e   4  bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includememccpy.cstddef.hstring.h<~'f!8+@  $! &$!f! |  ` |  `(T0@TH`T(U08UH`U W4HYBmemccpy``size_tmemccpy/u/raghu/ics_feb29p_endGNU C 4.4.3charbionic/libc/string/memccpy.cunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.memccpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p1Z  np"j T  z<`p  \   l px t pT pr  p p0c0o'< `  &   ` bionic/libc/string/memccpy.cmemccpy !%1>DO S i x             ) - 4 8 ? C R V e i    memchr.o/ 1331265333 1002 1002 100644 3808 ` ELFP4( % RU$ > : ; I$ > .? : ; ' I@ : ; I: ; I 4: ; I 4: ; I   I & &ID(int;WP&,sc)Un0)p!< end"V    p bionic/libc/stringbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includememchr.cstring.hstddef.h MKKK4Lx|!0+>@Ce$+8F72$+HF0 +E$+XF)`$#'X!8fh$i$x ph !8N!@M! DGLDM HNB$+xFX!B$B$B$! |  , |  ,T T$,TV RR $R$,RBmemchr,,size_tunsigned char/u/raghu/ics_feb29bionic/libc/string/memchr.cGNU C 4.4.3memchrunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.memchr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p"Z x nptj  zP,p|    0pp 8p, pI  pi p0yd0o ` t $   , bionic/libc/string/memchr.cmemchr !%1>DO S g             ) - < @ G K R V ] a    memmem.o/ 1331265333 1002 1002 100644 4664 ` ELFP4(!H% RU$ > : ; I$ > .? : ; ' I@: ; I: ; I  4: ; I 4: ; I 4: ; I   I&&IK8int;g1,hW#!n#0``#m#0, y) x* j+0 k,0 l,0   T bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includememmem.cstddef.hstring.h#<IKJe0vNzJF JGzJt (<'!'D@<840,($ +!@!!D@<840,($ H'!,&`$אӐ&$!  (#$!!$!G&&!(! !0 @JW!@!>+X`!!!)Ő!0D@<840,($  H' | 0hPHh   | 0hPHh  h LTLx`xT```hT LUL`f`UfUf,0U0Hf V,8V W,hWLta,aLXn,nBmemmemhhsize_tunsigned charbionic/libc/string/memmem.cmemmem/u/raghu/ics_feb29GNU C 4.4.3haystackneedleunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.memmem.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p8Z  np.Xj ` ~hz h  pD 4D px8 pp p  p (p0t0qo   d;   h $-4bionic/libc/string/memmem.cmemmem_gp_dispmemcmpmemchr !%1>DO S W `j w |        0        ! % , 0 7 ; B F M Q ` d k o v z                         % )    memrchr.o/ 1331265333 1002 1002 100644 3508 ` ELF,P4( % RU$ > : ; I$ > .? : ; ' I@ : ; I : ; I  4: ; I 4: ; I   I &&I3int;P&'sTc)Un0| p" q#   .Q bionic/libc/stringbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includememrchr.cstring.hstddef.htMKKHKIIKx!!C$G$F$+@d+H+PKe Ce@IB$ %+8DFC$!`!! |  |   VRRBmemrchrsize_t/u/raghu/ics_feb29GNU C 4.4.3memrchrcharbionic/libc/string/memrchr.cunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.memrchr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p)Z  npUj <  z<p  D   T p1 \ 0pI pg  p p0]0o, `  &    bionic/libc/string/memrchr.cmemrchr !%1>DO S }             "    memswap.o/ 1331265333 1002 1002 100644 3424 ` ELFP4( % RU$ > : ; I$ > .? : ; ' @ : ; I4: ; I 4: ; I    IE,int;Q-4m1m2n0<p T?!Vq"U $tmp%W  ^ bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includememswap.cstddef.hstring.hMIKLIG!0+@$$ |  4 |  4 T,4T$U,4UVBmemswap44size_tmemswapbionic/libc/string/memswap.c/u/raghu/ics_feb29p_endGNU C 4.4.3unsigned intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.memswap.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 0 >xLpx^pZ 8  npj  z4p0  P  ppO Pp 8 p  @ p P p0 c0po `  &   4 bionic/libc/string/memswap.cmemswap !%1>DK O d r             " ) - < @    strcasecmp.o/ 1331265333 1002 1002 100644 4608 ` ELFP4($!% RU$ > : ; I$ > .? : ; ' I@ : ; I 4: ; I I &I : ; I U I !I/ $ > 4: ; I TXEint;z'"Ml.9)Xs1MTs2MUcmOus1Pus2Q  B9:)h.s1ZTs2ZU nZ0 cm]us1^us2_ B> >d)R .? bionic/libc/stringbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includestrcasecmp.cstring.hstddef.h(^((z<'!!$!0!PƐI!@!Bc$!0!#<'!$%!!8!Xj!H! )B"fc$!#"  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ |  X h |  X $h VX`V-XTstrcasecmpstrncasecmp$Xh X`hXhsize_tbionic/libc/string/strcasecmp.cu_charstrcasecmpstrncasecmp/u/raghu/ics_feb29GNU C 4.4.3charmapunsigned charunsigned intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strcasecmp.rel.text.strncasecmp.rodata.charmap.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 H">Lp^pVXZ X" npCj " ~Xz  " Lh 0 "p0 P "0 p"p  "p21 "pc( "p0  @"p0'0G0oYi@L# I   ! )X 4=hbionic/libc/string/strcasecmp.ccharmapstrcasecmp_gp_dispstrncasecmp  !%1>CPVa e   BN  #       $ (  (              $ strcasestr.o/ 1331265333 1002 1002 100644 5180 ` ELF P4(!???8% RU$ > : ; I$ > .? : ; ' I : ; I.? : ; ' I@: ; I : ; I 4: ; I 1RUX Y  1 1RUX Y  I&I4: ; I? < F%~Hint;qR)^c)>s+ Z+j c- sc- len.0 Bd1 T B 7 T,1 _869*05gD:* bionic/libc/stringbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includestrcasestr.cctype.hstddef.hstring.h+0 (JJHJJ?MIJJJJJJJz<'!'40,($  @!4!0,($ 8'G0$c@ $!d! @ U!@ 1I%!(@@ !0m&!`u!  @! ! | (P8\ | (P8\8 <T<\`\dTd`a` <U<TbTUb4<R<HedRe<dXXX<LddlW<dZ[Z[[ZJ^strcasestrdhlxsize_t/u/raghu/ics_feb29strcasestrGNU C 4.4.3char_tolower_tab__toupper_tab_tolowerfind_ctype_short intunsigned intbionic/libc/string/strcasestr.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strcasestr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pcJZ  npj  ~0z ( p < \< pv p! p/  pOX p00E oWg  LV   ! ,5CJbionic/libc/string/strcasestr.cstrcasestr_gp_disp_tolower_tab_strlenstrncasecmp !%1>D`k o s          8= d x          $ + / 6 : A E L P W [ j n u y                         , 0 7 ; B F M Q X \ c g         $ ( , 0 4 8 < H L strcat.o/ 1331265333 1002 1002 100644 3128 ` ELFP4( |% RU$ > $ > .? : ; ' I@ : ; I: ; I 4: ; I I &IT%Aint7yHys,y ,U .y R bionic/libc/stringbionic/libc/includestrcat.cstring.h/J>`!!c$dc$c$$fc$! |  H |  H T R@S@HR7strcatHHunsigned intappendstrcatcharsavebionic/libc/string/strcat.c/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strcat.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 8 >xLpx^pZ @ p npj  zHp\  |  p4 @p  p   p  ( p0`0}o `  $   H bionic/libc/string/strcat.cstrcat !%39D H \ an_          ! %    strchr.o/ 1331265333 1002 1002 100644 2976 ` ELFLP4( <% RU$ > $ > .? : ; ' I@ : ; I: ; I  I&IC0int 1m4mp"zch")UsOslR bionic/libc/stringbionic/libc/includestrchr.cstring.h$Ke!`B$Ce! |  4 |  4 T ,R7strchr44unsigned intstrchrbionic/libc/string/strchr.c/u/raghu/ics_feb29GNU C 4.4.3charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strchr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxs^pZ ` npqpj 8  z4p  @ 8  P pX X pv x p  p p0T0o)9L `  $   4 bionic/libc/string/strchr.cstrchr !%39D H \ v_           strcoll.o/ 1331265333 1002 1002 100644 3064 ` ELF(P4(!% RU$ > $ > .? : ; ' I@ : ; I I&IJ7int U)ps1%ps2%pv{iS bionic/libc/stringbionic/libc/includestrcoll.cstring.h% <'!  |   |   T U7strcollunsigned intstrcollcharbionic/libc/string/strcoll.c/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strcoll.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpxd^pZ  h np_mj x  ~z  p    p$& pJ ph  p p0V0oP    6    &/bionic/libc/string/strcoll.cstrcoll_gp_dispstrcmp !%39D H ] k ~`            strcspn.o/ 1331265333 1002 1002 100644 3328 ` ELFxP4( % RU$ > : ; I$ > .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I  I &I= *int;VNN04s1(Ts2(Up**S c+W sc+V  I bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrcspn.cstddef.hstring.h0}L!!GH$!fc$#D |  4 |  4RXR4XBstrcspn44size_tspanpbionic/libc/string/strcspn.c/u/raghu/ics_feb29GNU C 4.4.3charstrcspnunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strcspn.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  p npj x  z4p  <  p\4 @p p  p p0c0AoScx `  &   4 bionic/libc/string/strcspn.cstrcspn !%1>DO S            ! %    strdup.o/ 1331265333 1002 1002 100644 3872 ` ELFP4(!t(% RU$ > : ; I$ > $ >  I.? : ; ' I@: ; I 4: ; I 4: ; I &In(Dint;Wz;tstr' siz)03 #*  bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrdup.cstddef.hstring.h+=$<'!'$  F$! !@@ ! @$! (' | tP(H | tP(Ht( T08Vstrdupttlong long intsize_tunsigned charcopybionic/libc/string/strdup.c/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3long intlong unsigned intdoubleshort unsigned intsigned charfloatshort intunsigned intstrdupcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strdup.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj p ~tz x( p, , pF @p" p?  p_ p0o0Soeu   T B   t $-4;bionic/libc/string/strdup.cstrdup_gp_dispstrlenmallocmemcpy !%1>ELSZahov}       0 T         $ 3 7    strerror.o/ 1331265333 1002 1002 100644 3360 ` ELFP4("d % RU$ > $ > .? : ; ' I@: ; I4: ; I  II !I/ $ > L9intBuDunum#) buf%{ { mT bionic/libc/stringbionic/libc/includestrerror.cstring.h#><'!'& $& ' | DP H | DP HD 0T7strerrorDDunsigned intcharstrerrorbionic/libc/string/strerror.c/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strerror.bss.buf.1390.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ  p npqj x  ~Dz 0 LpL,  x,  p3 0 p  p   p   p0&X 0~o& !  E   (D 1:bionic/libc/string/strerror.cbuf.1390strerror_gp_dispstrerror_r !%39D H L_p ~a  $  4         $    strerror_r.o/ 1331265333 1002 1002 100644 12400 ` ELFP4($!(% RU$ > : ; I$ > $ >  I : ;  : ; I8 : ; I8 &I .: ; ' I  : ; I 4: ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I1X Y 1 41 U1RUX Y 41I!I/ 4: ; I Oint;b&n>\6  )# msg #  Q,0 num,; i.0 <+G+) nn)1 /9) num9)9)09)90 end90 pos;0 a<; neg=)C)]) ]_7]0_) len`)ret`)msga/@|dM @|  retn)6(nsh]RGP~MkxH$ c bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrerror_r.cstddef.hstring.h$E?uTlJiJMKEMLIK  JkJK?@,ALBdCxDEFGJIMOP@Q\R|STUVW4X\[t\^_`abc8xPyhz{|} ~ 8 H `  4 d  , H d m  $ < X d | P(P | P(P( 8T8`Dt`|`` 8U88bDlb|bb 8V8aDpa|aa@\R|RDTR<DRdhRRLUDTUDSdS`$T$,`,D\d|\|T`DVdVVSstrerror_rD`dD`dD`d_sys_error_stringssave_errnoCodeStringstart__itoafloat__code_string_lookup__digits10long unsigned intshort unsigned intsize_tsignunsigned charchardoublecodestrerrbufunsigned intlong long unsigned intstrerror_rlong long intbionic/libc/string/strerror_r.cGNU C 4.4.3errnumshort intbufferbuflenlong intstrings/u/raghu/ics_feb29signed charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.strerror_r.rel.data.rel.ro.local._sys_error_strings.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 x&">xLpxe^pZ &" npgj `(" z28|  h(X"X ("pp0 ,"0 ,"p ,`"p! H/"p   P/"!p  `/"/p0n:03CoEUSH$# &]   !4  9DMUbionic/libc/string/strerror_r.c_sys_error_strings$LC0strerror_r_gp_disp__errnostrlcpy !%1>ELSZahov} 7S^i   % ) > B Nb f   $ @ D l  | P D     $ , 4 < D L T \ d l t |                     $ , 4 < D L T \ d l t |                     $ , 4 < D L T \ d l t |                     $ , 4 < D L T \ d l t |                           $ + / 6 : A E L P _ c j n u y                           / 3 : > M Q X \ k o v z                            ( , 0 4 8 < @ D P T X \ ` d h l x |         strlcat.o/ 1331265333 1002 1002 100644 4596 ` ELFdP4(! % RU$ > : ; I$ > $ >  I.? : ; ' I@: ; I 4: ; I 4: ; I &I6eint!;(xSK0dst src>siz0\ d s! n"0 #0 ` bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrlcat.cstddef.hstring.hLLLKIHMIKvI uJ JvyM<'!'%,@!!$gB$Hc$#d#0!$B$g$c$G#E`!P '! ! !P '!!! | P H | P H TT UU @V@tRtVVRRV8SSSStR\VVV!strlcatlong long intshort unsigned intsize_tunsigned charbionic/libc/string/strlcat.clong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3charlong intdoubledlenstrlcatsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strlcat.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 D>xLpx^p!Z L np/dj < ~z D  p|, d, tp! |Pp p  p3 p0C0)o;K    6    &/bionic/libc/string/strlcat.cstrlcat_gp_dispstrlen !%1>ELSZahov}           `         $ + / > B I M \ ` g k r v }                           strlcpy.o/ 1331265333 1002 1002 100644 3888 ` ELFP4( % RU$ > : ; I$ > $ >  I.? : ; ' I@ : ; I : ; I 4: ; I 4: ; I &I r#Hint;[~@L0hdst srcUsiz0) dG se n 0  5 bionic/libc/stringbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includestrlcpy.cstring.hstddef.h)XJ; KlJ $!0F!gc$$dc$'0!f!dc$'0!f |  h |  h(T08T@TT VL`V8T@LT LSPhSstrlcpyhhlong long intsize_tunsigned charbionic/libc/string/strlcpy.cstrlcpy/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3charlong intlong unsigned intdoubleshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strlcpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np,9j X zhhp  `  pp xp p  p p00o ` X &   h bionic/libc/string/strlcpy.cstrlcpy !%1>ELSZahov}                ) - 4 8 G K R V e i p t    strncat.o/ 1331265333 1002 1002 100644 3584 ` ELFP4( % RU$ > : ; I$ > .? : ; ' I@ : ; I: ; I   4: ; I  I &I7$int;PHFPdst)src)?n)0VH d,] s-{ C   bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrncat.cstddef.hstring.h*IMGM!`!c$dc$c$$g$c$` |  P |  PTRTHRHPT4UHPUPSPPS(PUBstrncatPPsize_tbionic/libc/string/strncat.c/u/raghu/ics_feb29GNU C 4.4.3charstrncatunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strncat.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np!j   zPpH  h  0 p 8 p p4  pT p0d]0o ` X &   P bionic/libc/string/strncat.cstrncat !%1>DO S i x               ! % , 0 ? C J N ] a h l {     strncpy.o/ 1331265333 1002 1002 100644 3436 ` ELFP4( |% RU$ > : ; I$ > .? : ; ' I@ : ; I: ; I  U 4: ; I  I &I?$int;P7IXdst.src.n.0V d1S s2U K   bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrncpy.cstddef.hstring.h/ByI !!$dc$$$$`c$ |  X |  XTXRU,4UBstrncpyX ,4PXsize_tbionic/libc/string/strncpy.c/u/raghu/ics_feb29strncpyGNU C 4.4.3charunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strncpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 D >xLpx^pZ L x np"j  zXpH  h  p< @p $ p  , p( < 0p0*]0o `  &   X bionic/libc/string/strncpy.cstrncpy !%1>DO S i x          " ) -        strndup.o/ 1331265333 1002 1002 100644 3972 ` ELFP4(!t0% RU$ > : ; I$ > $ >  I.? : ; ' I@: ; I 4: ; I &IlYint;B}(x:Gs n03 !0 #"  bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrndup.cstddef.hstring.h O<'!',($ !+ Q &!!@@! @ !0 !@,!($0' | P0L | P0L0 (T 0U0T`Tastrnduplong long intsize_tunsigned charcopylong unsigned intstrnduplong long unsigned int/u/raghu/ics_feb29GNU C 4.4.3charlong intdoubleshort unsigned intsigned charunsigned intfloatbionic/libc/string/strndup.cshort intslenGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strndup.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj  ~ z ( p0 0 p\ `pT \pr  dp tp00o    D    &/6=bionic/libc/string/strndup.cstrndup_gp_dispstrlenmallocmemcpy !%1>ELSZahov}       < \         $ 3 7 > B I M    strnlen.o/ 1331265334 1002 1002 100644 3556 ` ELFP4(!t(% RU$ > : ; I$ > .? : ; ' I@: ; I: ; I4: ; I  I &IX Eint6;=E0Xstr /0>p  *  bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrnlen.cstddef.hstring.hK>N<'!'$ !!0!( !#Q$ "! (' | XP(L | XP(LX( 8T8<a 0U0P`BstrnlenXXunsigned intbionic/libc/string/strnlen.ccharmaxlensize_tstrnlen/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strnlen.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj $  ~Xz ,  p0 D D0 T pt\ \ `p p  p p0d0o   d 6   X &/bionic/libc/string/strnlen.cstrnlen_gp_dispmemchr !%1>DO S W j oy  $         $ + / > B I M    strpbrk.o/ 1331265334 1002 1002 100644 3168 ` ELFP4( % RU$ > $ > .? : ; ' I@ : ; I: ; I 4: ; I 4: ; I  I &I 7 intTO@s1%s2%U1'Sc()Vsc()T ,  xS bionic/libc/stringbionic/libc/includestrpbrk.cstring.h)=!!F G$!dc$! |  @ |  @T W R8W88R7strpbrk@@unsigned int/u/raghu/ics_feb29GNU C 4.4.3charscanpbionic/libc/string/strpbrk.cstrpbrkGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strpbrk.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 X >xLpx^p Z ` h np|j  z0@pp    p? Pp 8 p   @ p- P p0=\0o ` 0 &   @ bionic/libc/string/strpbrk.cstrpbrk !%39D H ] n`          ! % , 0    strrchr.o/ 1331265334 1002 1002 100644 2808 ` ELF P4(|% RU$ > $ > .? : ; ' I@ : ; I 4: ; I  I&IJ7int/2x$xp"Tch")U$xR~V~lS bionic/libc/stringbionic/libc/includestrrchr.cstring.h%!$&0e`  |  $ |  $7strrchr$$saveunsigned intbionic/libc/string/strrchr.cstrrchr/u/raghu/ics_feb29GNU C 4.4.3charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strrchr.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 H >xLpxs^pZ P ` np|pj  z$p  0  pP pn  p p0[0o P  &   $ bionic/libc/string/strrchr.cstrrchr !%39D H k`       strsep.o/ 1331265334 1002 1002 100644 3712 ` ELF4P4( % RU$ > $ > $ >  I&I.? : ; ' I@ : ; I 4: ; I 4: ; IlBintU0)P`/T/U s1 #2? c3)R sc3)e tok4xwR bionic/libc/stringbionic/libc/includestrsep.cstring.h/ uLL~N@!8@!8 ($!fc$!H! |  ` |  `R Y (W(XYXXRXSXXXVXXRstrsep``long long intunsigned intstringpspanpstrseplong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/string/strsep.cdelimGNU C 4.4.3charlong intdoubleshort unsigned intsigned charunsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strsep.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np{j  z`p    p< p Xp  `p pp00o"4 `  $   ` bionic/libc/string/strsep.cstrsep !%3:AHOV]dkry       _          ! % , 0 ? C R V e i x |    strspn.o/ 1331265334 1002 1002 100644 3316 ` ELFP4( % RU$ > : ; I$ > .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I : ;   I &IC0int;T)Q04s1%Ts2%Up'#'S c(W sc(V a1  O bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrspn.cstddef.hstring.h&QJ!GH$!fc$!#D |  4 |  4 R 4XBstrspn44size_tbionic/libc/string/strspn.cspanpstrspn/u/raghu/ics_feb29GNU C 4.4.3charunsigned intcontGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strspn.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^p#Z  npj  z4p8  X  px p p  p p0f0Io[k `  $   4 bionic/libc/string/strspn.cstrspn !%1>DO S              strstr.o/ 1331265334 1002 1002 100644 4132 ` ELFP4(!t0% RU$ > : ; I$ > .? : ; ' I@: ; I: ; I4: ; I  I &I+int;SG=s( N(jc*sc*len+0 &   bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrstr.cstddef.hstring.h,, v$IKMz<'!',($  @!,!($ 0'$ ! `!@!(` @!0&R!  @! ! | $P0X | $P0X0 8T8T`T\T\`a` 8U8HcHdUdc0Lb\b8@RtRR8DdtdBstrstrsize_t/u/raghu/ics_feb29GNU C 4.4.3charbionic/libc/string/strstr.cstrstrfindunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strstr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np$j  ~z   p8 8 p 0p p0  pP p0``0o    <    $-4bionic/libc/string/strstr.cstrstr_gp_dispstrlenstrncmp !%1>DO S W h mw     \ x         $ + / 6 : A E L P W [ j n u y                      strtok.o/ 1331265334 1002 1002 100644 4520 ` ELFP4(# % RU$ > $ > .? : ; ' I@ : ; I: ; I 4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I4: ; I O/inte@s)I)U[)V)+Uc,)~sc,)tok- n: `   B?s! I![#R bionic/libc/stringbionic/libc/includestrtok.cstring.h)JuLLMKnq&!$$!C`B$! `!8 $!CB$!ɬ!Hɬ!!Č!<'! $ |   |   $T@W@LYLTWTYWTtR|RRXSt|RRRR T U& 7strtok_rstrtok$bionic/libc/string/strtok.cunsigned intspanp/u/raghu/ics_feb29strtokdelimGNU C 4.4.3lastcharstrtok_rcontGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strtok_r.rel.text.strtok.bss.last.1391.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp^pi Z ! npj ! z0 (!p0  !$0 8!pT H !pR* h!p|( p!p  !p0s0/$oAQ4 " @   ' 07bionic/libc/string/strtok.clast.1391strtok_rstrtok_gp_disp  !%39D H \an{    _       $ (  (       ! % , 0 7 ; B F U Y ` d k o ~                      strtotimeval.o/ 1331265334 1002 1002 100644 4184 ` ELFP4(!d(% RU$ > $ > $ > : ; I I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I &I4: ; I? <  int5I" ,W393ai4acd## !LF str!F ts!Q3 n#) s$p s0$ fs%aL O8F~9qw EA:q bionic/libc/stringbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxbionic/libc/includestrtotimeval.cposix_types.htypes.htime.hctype.h!EOhJJL<'!'$ ! $ '$ (' | LP(H | LP(HL( 0T (U(D`strtotimevalLLstrtotimeval/u/raghu/ics_feb29short unsigned intfloat__kernel_time_tunsigned charlong unsigned int__kernel_suseconds_t_tolower_tab_doubletimevalunsigned intlong long unsigned inttime_ttv_usectv_seclong long intGNU C 4.4.3charbionic/libc/string/strtotimeval.csuseconds_tshort intlong intsigned char_toupper_tab__ctype_GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strtotimeval.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p=Z  npj  ~Lz  p, <, phQ Pp# 0p  8p Hp0 W0c ou   LC   #L 09bionic/libc/string/strtotimeval.cstrtotimeval_gp_dispstrtoumax !%3:AHOV]dkry     Xe}          $ 3 7 > B    strxfrm.o/ 1331265334 1002 1002 100644 3724 ` ELF P4(!t0% RU$ > : ; I$ > .? : ; ' I@: ; I4: ; I I &I3int;P+V0ts1' s2'>n'0\len)0z&  bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includestrxfrm.cstddef.hstring.h'IK@FNv<'!',($!! P$+ 0 ! ,!($0' | tP0L | tP0Lt0 0T0ha ,U08U 0VHTVDl`Bstrxfrmttsize_t/u/raghu/ics_feb29GNU C 4.4.3charstrxfrmbionic/libc/string/strxfrm.cunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.strxfrm.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ  npj  ~tz  p80 h0 p p% dpC  lpc |p0s]0o4    =   t &/6bionic/libc/string/strxfrm.cstrxfrm_gp_dispstrlenmemcpy !%1>DO S W i w     H         $ + / > B I M \ ` g k z ~    wcpcpy.o/ 1331265334 1002 1002 100644 3504 ` ELFP4( <% RU$ > $ > $ > : ;I.? : ; ' I@ : ; I: ; I  I &Iy;intN)qCEj),to)e)U    bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includewcpcpy.cstddef.h)HLJJJ!`$B$D |  , |  ,T$R$,Twcpcpy,,long long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intfromwcpcpywchar_tGNU C 4.4.3bionic/libc/wchar/wcpcpy.clong intdoubleshort unsigned intsigned charfloatshort intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcpcpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 p >xLpx^pZ x  npj 8  z,p  @ <  P p\) X 0p p  p p00o ` L #   , bionic/libc/wchar/wcpcpy.cwcpcpy !%,3:AOV]dkry                wcpncpy.o/ 1331265334 1002 1002 100644 3704 ` ELFP4( |% RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I : ; I  4: ; I  I &I}C#intV1LuCEm!Pdst! src!U n!V ,D ret&    bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includewcpncpy.cstddef.h!JIK J!$ B$$`C!@B$$@!` |  P |  PT4R48S8HRHPR wcpncpyPPbionic/libc/wchar/wcpncpy.csize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwcpncpywchar_tGNU C 4.4.3charlong intdoublelong long intshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcpncpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^p$ Z   np-j  zDPp    p? Pp Pp1  XpQ hp0a0Io[k `  %   P bionic/libc/wchar/wcpncpy.cwcpncpy !%,3:AOV]dkry               ! % , 0    wcscasecmp.o/ 1331265334 1002 1002 100644 4216 ` ELFhP4(!4(% RU$ > $ > $ > : ;I.? : ; ' I@: ; I4: ; I  I &IZ:int-mHCEsEs1" s2"Ic1$}c2$  ' bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcscasecmp.cstddef.hwchar.h"$MzGM;KIK<'!'$ !!"1& &$ !@B$#B ('"$# (' | P(P | P(P( ,T,`` 4U4aaU<|bb<TRpxRRwcscasecmplong long intbionic/libc/wchar/wcscasecmp.cunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intwcscasecmpdoubleshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wcscasecmp.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 P>xLpx^pZ X np+j 0 ~$z 8  p0 X0 hp0 pp! Pp  Xp5 hp0E0, o>N   =     +4bionic/libc/wchar/wcscasecmp.cwcscasecmp_gp_disptowlower !%,3:AOV]dkry        H \         $ + / 6 : I M T X _ c j n }             wcscat.o/ 1331265334 1002 1002 100644 3664 ` ELF\P4( |% RU$ > $ > $ > : ;I.? : ; ' I@ : ; I: ; I 4: ; I  I &Im;intN~)yeCEtHs1(s2(U cp*4   ! bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcscat.cstddef.hwchar.h(I@z`!!c$dc$c$$fc$! |  H |  H T RTHR@S@HSwcscatHHlong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intdoubleshort unsigned intsigned charwcscatfloatshort intbionic/libc/wchar/wcscat.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcscat.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np%j  z Hph    pR `p (p  0p7 @p0G0&o8H\ `  #   H bionic/libc/wchar/wcscat.cwcscat !%,3:AOV]dkry              ! % 4 8 ? C    wcschr.o/ 1331265334 1002 1002 100644 3536 ` ELFP4( <% RU$ > $ > $ > : ;I.? : ; ' I@ : ; I: ; I  I &It;intN)eCEmu4s!c!U    bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcschr.cstddef.hwchar.h!Ie!`B$Ce  |  4 |  4 T $R$,T,,Rwcschr44long long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_twcschrGNU C 4.4.3charbionic/libc/wchar/wcschr.clong intdoubleshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcschr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj H  z4p0  P P  ` pp4 h @p p  p p00o ` d #   4 bionic/libc/wchar/wcschr.cwcschr !%,3:AOV]dkry             ! %    wcscmp.o/ 1331265334 1002 1002 100644 3264 ` ELFP4(<% RU$ > $ > $ > : ;I.? : ; ' I@ : ; I  I &I)VintiDCEvE,s10Ts20U  bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcscmp.cstddef.hwchar.h0=$C$@#C |  , |  ,wcscmp,,long long intunsigned intunsigned charbionic/libc/wchar/wcscmp.clong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intwcscmpGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcscmp.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxz^pZ  npj x  z,p  (  pH pe  p p00toL P  #   , bionic/libc/wchar/wcscmp.cwcscmp !%,3:AOV]dkry         wcscoll.o/ 1331265334 1002 1002 100644 3564 ` ELFP4(!% RU$ > $ > $ > : ;I.? : ; ' I@ : ; I I &IxN.int!a<CEwEws1$ws2$  bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcscoll.cstddef.hwchar.h$ <'!  |   |   T Uwcscolllong long intshort unsigned intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/wchar/wcscoll.cwchar_tGNU C 4.4.3charlong intwcscolldoublesigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wcscoll.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxz^pZ  npj l  ~z t  p    p4& pZ px  p p00o   l 5    %.bionic/libc/wchar/wcscoll.cwcscoll_gp_dispwcscmp !%,3:AOV]dkry                wcscpy.o/ 1331265334 1002 1002 100644 3488 ` ELFP4( <% RU$ > $ > $ > : ;I.? : ; ' I@ : ; I: ; I 4: ; I  I &It;intN)lCEex$s1(s2(U cp*S    bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcscpy.cstddef.hwchar.h(MK@!!$dc$ |  $ |  $ T $Rwcscpy$$long long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwcscpywchar_tGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intbionic/libc/wchar/wcscpy.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcscpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 x >xLpx^pZ  npj 8  z$p4  @ T  P pt X p x p  p p00o ` T #   $ bionic/libc/wchar/wcscpy.cwcscpy !%,3:AOV]dkry              wcscspn.o/ 1331265334 1002 1002 100644 3840 ` ELFP4( % RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I : ; I 4: ; I : ;   I &Itint?M-LlCEdyxs( set(U p* q+1 (8d  / bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcscspn.cstddef.hwchar.h(vGyJ? t`!8 h! fB$F$`## #! |  x |  x\TdxTpWPRX\RdhRwcscspnxxshort unsigned intsize_tunsigned chardonelong unsigned intlong long intlong long unsigned intwcscspnwchar_tGNU C 4.4.3char/u/raghu/ics_feb29long intdoublebionic/libc/wchar/wcscspn.csigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcscspn.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 p >xLpx^p*Z x  np03j X zdxp  `  ppZ x`pv p  p p00o ` H %   x bionic/libc/wchar/wcscspn.cwcscspn !%,3:AOV]dkry               " 1 5 < @ G K    wcsdup.o/ 1331265334 1002 1002 100644 3864 ` ELF|P4(!t(% RU: ;I$ > : ; I$ > $ > .? : ; ' I@: ; I 4: ; I 4: ; I  I &Id:C5intGM("ls" #$ len%<3 )  ) bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includewcsdup.cstddef.h"x=$KI <'!'$ F$  ! @@$ ('$(' | lP(D | lP(Dl( T,4Vwcsduplllong long intsize_tunsigned charcopylong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/wchar/wcsdup.cwchar_tGNU C 4.4.3charlong intwcsdupdoubleshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wcsdup.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj h ~lz p( pt( ( pF @p  p'  pG p0W0BoTd   D B   l #,3:bionic/libc/wchar/wcsdup.cwcsdup_gp_dispwcslenmallocwmemcpy !%*=JQX_fmt{       , P         $ 3 7    wcslcat.o/ 1331265334 1002 1002 100644 4548 ` ELFLP4(! % RU$ > : ; I$ > : ;I$ > .? : ; ' I@: ; I 4: ; I 4: ; I  I &I)o=int;C)P+{g10dst1 src1!Isiz10g d3 s4! n50 60 B ' B< bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includewcslcat.cstddef.h1ILLLKIH xLpx^p-Z 4 npH@j , ~z 4  pt, T, dp  l0p p  p p0%0o$4t   5    %.bionic/libc/wchar/wcslcat.cwcslcat_gp_dispwcslen !%1>CQX_fmt{          `          $ + / 6 : I M T X g k r v }                       wcslcpy.o/ 1331265334 1002 1002 100644 4028 ` ELF$P4( |% RU$ > : ; I$ > : ;I$ > .? : ; ' I@ : ; I : ; I 4: ; I  I &Ig5int;_C)Hx#s/0t dst/  src/Usiz/0) d1 G s2{ n30 B  B bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includewcslcpy.cstddef.h/ p>!DB$#0EB$$ !CB$`$$ |  t |  t T$@T\dTV$(V T$T4\T\tTR4\R\tRV(tVwcslcpyttlong long intsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intdoublebionic/libc/wchar/wcslcpy.cshort unsigned intsigned charfloatshort intunsigned intwcslcpyGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcslcpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np<j  z@tp    p p p  p p00o$ `  %   t bionic/libc/wchar/wcslcpy.cwcslcpy !%1>CQX_fmt{                 ) - 4 8 G K R V ] a h l {             wcslen.o/ 1331265334 1002 1002 100644 3484 ` ELFP4( % RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I 4: ; I  I &In5intH#zLfCE_{4s(T p*   bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcslen.cstddef.hwchar.h(Ix @!B$C`B$B$#D |  4 |  4(Rwcslen44long long intsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwcslenwchar_tGNU C 4.4.3charlong intdoubleshort unsigned intsigned charbionic/libc/wchar/wcslen.cfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcslen.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 | >xLpx^pZ  npj D  z4p<  L \  \ p| d p t p  | p p00o ` X #   4 bionic/libc/wchar/wcslen.cwcslen !%,3:AOV]dkry            wcsncasecmp.o/ 1331265334 1002 1002 100644 4704 ` ELFxP4(!t0% RU$ > $ > $ > : ; I: ;I.? : ; ' I@: ; I 4: ; I  I &I #Uint|CLtCEh|Es1" s2"_n" c1$ c2$  0 bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcsncasecmp.cstddef.hwchar.h"(}=EOv JsKIK<'!',($ !!! "B,$R& 1&D !@b&,#b($ 0',!($ 0'B,#($ 0' |  P0T |  P0T0 8T8aaTa 8U8bbUbU LVL``V`VLcccLlRRRR wcsncasecmplong long intsize_tunsigned charbionic/libc/wchar/wcsncasecmp.clong unsigned int/u/raghu/ics_feb29wcsncasecmpwchar_tlong long unsigned intGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wcsncasecmp.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 `>xLpx^p Z h np4j P ~Pz X( p@4 t4 pP p" 8p  @p: Pp0J0: oL\    ?   ! -6bionic/libc/wchar/wcsncasecmp.cwcsncasecmp_gp_disptowlower !%,3:AOV]dkry         @ ` t         $ + / 6 : A E L P _ c j n u y                           ' + 2 6 = A    wcsncat.o/ 1331265334 1002 1002 100644 3820 ` ELFP4( % RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I : ; I 4: ; I 4: ; I  I &IY'int:r{mLQCEe}Ps1(s2( ) n(V p*G q+T r, U   - bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcsncat.cstddef.hwchar.h(IILH`!$$$`$$`$ |  P |  P T HRHPT8UHPU@THPTwcsncatPPsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3wcsncatcharlong intdoublebionic/libc/wchar/wcsncat.clong long intshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcsncat.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 \ >xLpx^p,Z d  npC1j 4 ztPp  <  Lpe Tppi p  p p00o ` 4 %   P bionic/libc/wchar/wcsncat.cwcsncat !%,3:AOV]dkry               ) - 4 8 G K R V    wcsncmp.o/ 1331265334 1002 1002 100644 3328 ` ELFP4(|% RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I  I &Ig5intHx#sL_CE~E4s1*Ts2*Un*V   bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcsncmp.cstddef.hwchar.h*Ey$$C$@!#C |  4 |  4wcsncmp44long long intsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intwcsncmpdoubleshort unsigned intsigned charbionic/libc/wchar/wcsncmp.cfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcsncmp.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj  z4p4  T  pt p  p p00o P  %   4 bionic/libc/wchar/wcsncmp.cwcsncmp !%,3:AOV]dkry         wcsncpy.o/ 1331265334 1002 1002 100644 3768 ` ELFP4( |% RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I : ; I U 4: ; I  I &Io5intH#{LgCE_Xdst0src0 n0V d3S s4U     bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcsncpy.cstddef.hwchar.h0ByI !!$dc$$$$`c$ |  X |  XTXRU,4UwcsncpyX ,4PXlong long intsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwcsncpywchar_tGNU C 4.4.3charlong intdoublebionic/libc/wchar/wcsncpy.cshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcsncpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 8 >xLpx^p$Z @  np6 j  zXXp    (p< 0@p, ppJ  xpj( 0p00zo `  %   X bionic/libc/wchar/wcsncpy.cwcsncpy !%,3:AOV]dkry             " ) -        wcsnlen.o/ 1331265334 1002 1002 100644 3552 ` ELF P4( <% RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I : ; I 4: ; I  I &Ig=intP+LCE!Ds!T !U len#   bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includewcsnlen.cstddef.h!J @!`B$E$! |  D |  D<R<<RwcsnlenDDlong long intsize_twchar_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/wchar/wcsnlen.cGNU C 4.4.3charlong intdoublemaxlenshort unsigned intsigned charfloatwcsnlenshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcsnlen.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np j x  z DpP  p  p p p  p p00o  `  %   D bionic/libc/wchar/wcsnlen.cwcsnlen !%,3:AOV]dkry              wcspbrk.o/ 1331265334 1002 1002 100644 3644 ` ELFtP4( % RU$ > $ > $ > : ;I.? : ; ' I@ : ; I: ; I 4: ; I 4: ; I  I &I[ oint<SCEg\s(set(U p* q+V   ( bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcspbrk.cstddef.hwchar.h(>~wJ K`!!  !0$ g$njB$C`! |  \ |  \TP\TTRwcspbrk\\unsigned charlong unsigned intbionic/libc/wchar/wcspbrk.clong long unsigned intwchar_tGNU C 4.4.3wcspbrk/u/raghu/ics_feb29long intdoublelong long intshort unsigned intsigned charfloatshort intunsigned intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcspbrk.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ   np,j  z@\p    p1 0p  p+  pK ,p0[0<oN^t `  %   \ bionic/libc/wchar/wcspbrk.cwcspbrk !%,3:AOV]dkry             "    wcsrchr.o/ 1331265334 1002 1002 100644 3460 ` ELFP4( |% RU$ > $ > $ > : ;I.? : ; ' I@ : ; I 4: ; I  I &I1_#intrMCE$s!Tc!U#    bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcsrchr.cstddef.hwchar.h!F!$&0e`  |  $ |  $Rwcsrchr$$long long intunsigned intwcsrchrunsigned charbionic/libc/wchar/wcsrchr.clong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3lastcharlong intdoubleshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcsrchr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 d >xLpx^pZ l  npj ,  z$p   4 @  D p` L ps \ p  d p t p00o ` < %   $ bionic/libc/wchar/wcsrchr.cwcsrchr !%,3:AOV]dkry            wcsspn.o/ 1331265334 1002 1002 100644 3692 ` ELFP4( % RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I 4: ; I : ;   I &ItYint,:LQCEds(Tset(U p* q+ :d  ( bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcsspn.cstddef.hwchar.h(􃄀 wJ  @!8  H!c$Fc$f#$@# |  d |  ddWddWdSwcsspnddsize_tunsigned chardonelong unsigned intlong long intlong long unsigned intwchar_tbionic/libc/wchar/wcsspn.cGNU C 4.4.3char/u/raghu/ics_feb29long intwcsspndoubleshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcsspn.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ   np,j  zLdp    p1 0p! Dp>  Lp^ \p0n0Yok{ `  #   d bionic/libc/wchar/wcsspn.cwcsspn !%,3:AOV]dkry              "    wcsstr.o/ 1331265334 1002 1002 100644 4424 ` ELFP4(!t0% RU$ > $ > $ > : ; I: ;I.? : ; ' I@: ; I : ; I 4: ; I  I &Ig5intH#sL_CExs/ /_ c1 sc1 len2    bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcsstr.cstddef.hwchar.h/,MvIKMz<'!',($  !!,($ 0'$ ! `!@!(`@!0&Q! @ @!@ | $P0X | $P0X0 8T8T`T\T\`b <U<HcHdUdc0Pa\a<@RtRR8Ddtdwcsstrlong long intsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charwcsstrdoublelong intshort unsigned intsigned charfloatshort intunsigned intbionic/libc/wchar/wcsstr.cfindGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wcsstr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np1j  ~Pz   p8 48 pl  pd p  (p 8p00o   ;    #,3bionic/libc/wchar/wcsstr.cwcsstr_gp_dispwcslenwcsncmp !%,3:AOV]dkry         \ x         $ + / 6 : A E L P _ c j n u y                    wcstok.o/ 1331265334 1002 1002 100644 4244 ` ELFP4( % RU$ > $ > $ > : ;I.? : ; ' I@ : ; I: ; I 4: ; I 4: ; I : ;  I &I+kAintT/CEs))U*(V ),U tok-~ c. sc. :  # 2 bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcstok.cstddef.hwchar.h*JuLKK~MKnq&$$!C`B$! `!8 $!CB$ɬ!!Hɬ!!Č! |  |  T@W@LYLTWTYWTtR|RRt|RRRRXS/wcstoklong long intunsigned intunsigned charspanplong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/wchar/wcstok.cwchar_tdelimGNU C 4.4.3charlong intdoubleshort unsigned intsigned charwcstokfloatshort intlastcontGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wcstok.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 L>xLpx^p*/Z T npY6j L zp8  TX  dpx lpP lpm  tp p00o ` (#    bionic/libc/wchar/wcstok.cwcstok !%,3:AOV]dkry                 ! % , 0 7 ; B F U Y ` d k o ~               wcswidth.o/ 1331265334 1002 1002 100644 4332 ` ELFP4(!4(% RU$ > $ > $ > : ; I: ;I.? : ; ' I@: ; I : ; I 4: ; I  I &I p>intQ,|LhCE#E, n,T wc.} len/E l/E  - bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcswidth.cstddef.hwchar.h,$uNy<'!'$ !$1&! $$ &1& A!B$$!@ ('! | P(P | P(P( ,T,aTa 8U8`U0DTPhTxT<bbDhRlRwcswidthlong long intsize_tunsigned charwcswidthlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intshort intpwcsdoubleshort unsigned intsigned charfloatbionic/libc/wchar/wcswidth.cunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wcswidth.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np+1j  ~\z  p0 (0 pX p: pY  py p00xo   \8    '0bionic/libc/wchar/wcswidth.cwcswidth_gp_dispwcwidth !%,3:AOV]dkry         \         $ + / 6 : A E T X _ c j n }                 wcsxfrm.o/ 1331265334 1002 1002 100644 4592 ` ELF\P4(!|0% RU$ > $ > $ > : ; I: ;I I.? : ; ' I@ : ; I : ; I 4: ; I 4: ; I 4: ; I&IIqGintZ5LCE-; #; src#A_ len#r (%E sec%E l%E & ' s' ss'G' bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewcsxfrm.cstddef.hwchar.h#$ Jr=INFNFNy<<'!',($  @! !,!($ 0'!  !@+F`$!  !0@,!2! ($ 0' ! , | P0P | P0P0 0T0LaLXTXaa lU lVVV<P``R`R`Mwcsxfrmlong long intsize_tdestunsigned charprimwcsxfrmlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/wchar/wcsxfrm.cwchar_tGNU C 4.4.3charlong intunsigned intdoubleshort unsigned intsigned charfloatshort intmbsrcslenGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wcsxfrm.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 h>xLpx^p7MZ p np+j p ~z x( p0 0 p p p  p p0#0 o2B   $D    %.5=bionic/libc/wchar/wcsxfrm.cwcsxfrm_gp_dispwcslenwcsncpywcscpy !%,3:AOV]dkry        `           $ + / 6 : A E L P _ c r v }                   wmemchr.o/ 1331265334 1002 1002 100644 3652 ` ELF\P4( |% RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I : ; I 4: ; I  I &Io=intP+{LgCE#<s( c(U n(V i*S    bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewmemchr.cstddef.hwchar.h(K ! e!c$Dc$fB$! |  < |  <TRT4R4<Twmemchr<<long long intsize_tunsigned charwmemchrlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intunsigned intbionic/libc/wchar/wmemchr.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wmemchr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj  z4<pp    p? Pp p   $p- 4p0=0%o7G\ `  %   < bionic/libc/wchar/wmemchr.cwmemchr !%,3:AOV]dkry             ! % , 0    wmemcmp.o/ 1331265334 1002 1002 100644 3660 ` ELF|P4( % RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I : ; I 4: ; I  I &Ig5intHx#sL_CEE\s1( s2(U n(V i*  ( bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewmemcmp.cstddef.hwchar.h(OE zJ !B$$F$!*g$$  |  \ |  \PT@RHTRwmemcmp\\long long intsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intdoublewmemcmpshort unsigned intsigned charfloatshort intunsigned intbionic/libc/wchar/wmemcmp.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wmemcmp.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ  np,j  zD\p    p1 0p $p/  ,pO <p0_0GoYi| `  %   \ bionic/libc/wchar/wmemcmp.cwmemcmp !%,3:AOV]dkry             "    wmemcpy.o/ 1331265335 1002 1002 100644 3660 ` ELFP4(!@% RU$ > : ; I$ > : ;I$ > .? : ; ' I@ : ; I  I &IoEint;C)%X3d)s)n)0& B  B  bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewmemcpy.cstddef.hwchar.h) <'! 0 |   |   T U Vwmemcpylong long intsize_twmemcpywchar_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/wchar/wmemcpy.cGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wmemcpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj  ~z  p  <  p\9 0p $p  ,p <p00o,    5    %.bionic/libc/wchar/wmemcpy.cwmemcpy_gp_dispmemcpy !%1>CQX_fmt{              & *    wmemmove.o/ 1331265335 1002 1002 100644 3664 ` ELFP4(!@% RU$ > : ; I$ > : ;I$ > .? : ; ' I@ : ; I  I &I#Rint;|C)e@d)s)n)0& B  B  bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewmemmove.cstddef.hwchar.h) <'! 0 |   |   T U Vwmemmovelong long intsize_tunsigned charbionic/libc/wchar/wmemmove.clong unsigned int/u/raghu/ics_feb29long long unsigned intwchar_tGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intunsigned intwmemmoveGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.wmemmove.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  npj  ~z  p  <  p\9 0p (p  0p @p00o0    8    '0bionic/libc/wchar/wmemmove.cwmemmove_gp_dispmemmove !%1>CQX_fmt{              & *    wmemset.o/ 1331265335 1002 1002 100644 3572 ` ELF,P4( |% RU$ > $ > $ > : ; I: ;I.? : ; ' I@ : ; I : ; I 4: ; I  Io5intH#LgCE_$s( c(U n(V i*S p+T  bionic/libc/wchar/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includewmemset.cstddef.hwchar.h(KI!!c$f$ |  $ |  $TR$Twmemset$$long long intsize_tunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intwmemsetwchar_tbionic/libc/wchar/wmemset.cGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.wmemset.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ  np j |  z4$pX  x  p) 0p p  p p00o , `  %   $ bionic/libc/wchar/wmemset.cwmemset !%,3:AOV]dkry                bindresvport.o/ 1331265335 1002 1002 100644 6172 ` ELF P4("P% RU$ > $ > $ > : ; I : ;  : ; I8 I !I/  : ;  : ; I .? : ; ' I@ : ; I4: ; I 4: ; I I4: ; I &I4: ; I? < flwintGHS*:ra>L0!L $#%# } @-.#Vb##L## b#>r }   b  } } }Ar# ,)^ sd')! sin'^J)E*Hnn+)ret+)../00V bionic/libc/inetbionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/netinetbionic/libc/includebindresvport.ctypes.htypes.hsocket.hin.hin6.hin.hunistd.h'8OOKOzJwLx<CyJu,vyJoyDII<'!'LHD@<840,!T!$Xd;`$$X$$'ub0%2! !( $!@A Ds&$!`LHD@<840,P'X$s&$!`L HMxLpx^p|Z  np<Zj  ~z p `p`@ < @ L pI T p) #  pL   pl   p0| 0N o` p +! U   !+ 8AIPbionic/libc/inet/bindresvport.cport.2477bindresvport_gp_disp__errnogetpidbind !%3:AHOV]dkry*8FT{  ". 3JYe P T X `      $ @         ! % , 0 7 ; J N U Y ` d k o v z                            $ + / 6 :    inet_addr.o/ 1331265335 1002 1002 100644 4544 ` ELFP4(!$(% RU$ > $ > : ; I$ >  : ;  : ; I8  : ;  : ; I I !I/ .? : ; ' I@ : ; I4: ; I  I&I4: ; I &I4: ; I? < $(_intr&9o>40LS4C5S#>L0-.#  I) e9 )  9  I d#U% 4'dD cpA valCp .I /  8 9E~ :\? bionic/libc/inetbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/arpabionic/libc/include/netinetinet_addr.c_types.hstdint.htypes.htypes.hin6.hin.hinet.hin.hctype.hw=LK<'!'$ '@$('$(' | DP(D | DP(DD( $T(oinet_addrDD__u16__u32in6addr_anyfloatin_addrunsigned charinet_addr__uint32_tu6_addr16long unsigned intu6_addr32short unsigned intu6_addr8__be16_tolower_tab_doublein6addr_loopbacks_addrunsigned int__be32long long unsigned intin6_ubionic/libc/inet/inet_addr.c_ctype_long long int__u8GNU C 4.4.3charshort intuint32_tlong intin_addr_t/u/raghu/ics_feb29signed char_toupper_tab_in6_addrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.inet_addr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pt(Z ` np`j 0 ~Dz 8 p@( Ph( `p3 h0p  p  p p00 o   ;   D (1bionic/libc/inet/inet_addr.cinet_addr_gp_dispinet_aton !%3:AHOTahov}JVeq|    L          $    inet_aton.o/ 1331265335 1002 1002 100644 7284 ` ELFP4(!??0% RU$ > $ > : ; I$ >  : ;  : ; I8  : ;  : ; I I !I/ .? : ; ' I  : ; I.? : ; ' I@: ; I: ; I 4: ; I4: ; I4: ; I4: ; I 1RUX Y 11X Y  I&I4: ; I &I4: ; I? < Ax8intF[T40.t8Mk5S<>L0ev0> - .# $ $ _ 4 n D 4  D  T  o #}% R) c) ) c) $) c)))cpD  DUvalFoiG)nG)cH5IXppJz@ao(0y  , .T /&89 E:b bionic/libc/inetbionic/libc/includebionic/libc/include/arpabionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetinet_aton.cctype.hinet.h_types.hstdint.htypes.htypes.htypes.hin6.hin.hin.h,Qw JJJ!JJzJJIJuH JJGMJIIKHJJJKap<T$JJIIK:H8JIJJbJHHH:f$yrt<'!',($ F$ ,K`'0$'!x  $x$ $a$A $X$"Y.$ $T$$8J!0 . !p !&$T$$8J .!!@@! X'!bd$F$ ,`Y%$"R S$T$ # $JM0!Xml1 @!x%$WNQ(2 $4@!,($ 0'$!0D$$8J ,c$!@@! A!@Hb%c$I0! iA L I$!0 D0#H5b%0(c$c$$! ,R$S, 0%HtB:%(0%0$k,`! ,N,%S%x% <+!,F% <+H U, t,T%B% f | $P0X | $P0X0 TTSTS<S`pSSVTVhThV$V$pTpVTVTVTxXX0RX R 0X0<R<XRLX`XXTH_h$_ inet_aton@D$\`HT__u16__u32addrshort unsigned intisspacein6addr_anyfloatin_addrunsigned char__uint32_tu6_addr16baseu6_addr32bionic/libc/inet/inet_aton.cu6_addr8__be16parts_tolower_tab_long unsigned intin6addr_loopbackislowers_addrunsigned int__be32long long unsigned intin6_uinet_aton_ctype_long long int__u8GNU C 4.4.3charisxdigitshort intu_intuint32_tlong intin_addr_t/u/raghu/ics_feb29signed chardouble_toupper_tab_in6_addrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.inet_aton.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p Z  npj d ~z l p 8  8 pP  Pp  p9  pY H pp0 0e ow  H9    (1bionic/libc/inet/inet_aton.cinet_aton_gp_disp_ctype_ !%3:AHOTahov}Uap|       6 ;R [ _t x o <         $ + / 6 : A E L P W [ b f m q                             " & 5 9 @ D K O V Z a e l p w {                     $ ( , 8 < inet_ntoa.o/ 1331265335 1002 1002 100644 4528 ` ELFPP4(# 0% RU$ > $ > $ >  I: ; I : ;  : ; I8  : ;  : ; I I !I/ .? : ; ' I@: ; I 4: ; I 4: ; I4: ; I &I6int!&dH>L0-.#   w  > Z)  } ) } 9 }-T# 4*tin)b+p,  } .-9/ bionic/libc/inetbionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/netinetbionic/libc/include/arpainet_ntoa.ctypes.htypes.hin6.hin.hin.hinet.h)zJzP?%u.%u.%u.%u<'!',( B<1000&$ $,&(0' | tP0H | tP0Ht0Tinet_ntoatt__u16__u32in6addr_anyfloatin_addrunsigned charinet_ntoau6_addr16long unsigned intu6_addr32short unsigned intu6_addr8__be16__be32doublein6addr_loopbacks_addrunsigned intlong long unsigned intin6_ulong long int__u8GNU C 4.4.3charshort intlong int/u/raghu/ics_feb29signed charin6_addrbionic/libc/inet/inet_ntoa.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.inet_ntoa.bss.b.1976.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 !>xLpx^piZ 0! npRj ! z2\ ht @!p, P!, `!p4  h !pT  !pt  !p !p0S0$o 4 " F   % *t4=bionic/libc/inet/inet_ntoa.cb.1976$LC0inet_ntoa_gp_dispsnprintf !%3:AHOV]dkry:FVa e i  8 P ( T d           inet_ntop.o/ 1331265335 1002 1002 100644 12604 ` ELFDP4(# % RU$ > : ; I$ > $ >  I : ;  : ; I I !I/  : ;  : ; I8 &I.: ; ' I : ; I: ; I4: ; I : ;  : ; I8 4: ; I4: ; I.? : ; ' I@: ; I: ; I1X Y 1 41 411RUX Y  U 41!&"4: ; I #&IF8<gint ;zI)%{^YuD3IW;tISv;`/   /  ?  Z #` k ^esrc^Zdst^^0tmpgtphephi i)#leni)#Yicurij,ik)l) , - < HesrcHZdstHH0fmtJtmpKlL)    -eaf.)!src.Jdst..0 <2YcXM}~jnp48~  <pcXM}~{n!"i.$#?"/$ bionic/libc/inet/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetbionic/libc/include/arpainet_ntop.cstddef.htypes.htypes.htypes.hin6.hin.hinet.h.<IBF08J~94$IK,J yJvJvK:OGJL~px (fJ!J~JJ0~J~0iL~  ,fJ JtJ$<oyJ^L~J ,fIFOI~J  (f oJJ$HsJ JKfJJJf  iyJLJJ$GMqJ JfJJJf  %x<'!@' $!!! $6 !|$C!'DHG('$!  !(@ +8W!(!0 ! !'8'8 !('$$C!BP0!Hv.#x,hX%PlB$G*! !!($!$$ $C!&&!@!!c$i$!8!( !@!!.!0 H*ȱ* c$$i$$C**&(`&*$ FX''+(<$8s$$8!0!$*P*8C!@ R&!@!$!@!!`$!@!K@S$!@#! `!(@&%  @*PH@!bR&^+Xv`&!`$!`!0$!@b$+V#0E+8`U!!' !$W!'+@v:$DX'&*e>!* L!@'C$!@#! `!(@&%  @*PH@!b'$+ v&!`+Xv`: $ $M> J&^IB G#&! ` !(@ @+XR`! `!(` !0@` ! ` v!BC$+ v:$N$C$+0vz:$^EC$+vt:$g_!+ !@'$V+ vT&+!` !@C$+8v]:$$EL4 J&#`! `!(%  H@*pHE!b'! &*hP$*C `G!@R&!^+@v&*hP!`@S$!@#p! `!(%  @*H!bR&+v:$G$02!$#X! @!(`% !Br$ *(Js&+ v@+0V~&`: $i!`C$+0v:$EC$+ v:$_|$!$#! `!(`%  !d$*SR&+(v@+0`^&@:$o!%u.%u.%u.%u | 0Ph   | 0Ph   dTT0T PUPb b0bbTbb4bbbPTbb PVPdd0dd d PWP|g g0gg gRRS bRR8c8TSXdSdtRtSb  R 4cLxRxSSRS R  SX\StSbRSRSRSRS$R$<S<tRSRRSR4c4<S<<R<Pc\bSbRSRS@STX]XT\f|fff 4fDf bXRbTbXbnbb 4bPnnbnPb`cbn b,LRXdRtxRRRRRR(<RdRR$HRTRRHhRJinet_ntop 0 0hh__u16__u32size_tinet_ntop4inet_ntop6short unsigned intbionic/libc/inet/inet_ntop.cdoubleu6_addr8in6addr_anyfloatlong long unsigned intsizeu6_addr16baseu6_addr32u_char__be16__be32inet_ntoplong unsigned intin6addr_loopbackwordsunsigned charunsigned intin6_u%u.%u.%u.%ulong long int__u8GNU C 4.4.3charshort intu_intbestlong int/u/raghu/ics_feb29signed charadvancein6_addrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.inet_ntop.rodata.fmt.2631.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 %!>xLpx^p*JZ %0! nptj D'! z2   L'!4 p@D \(!D l(!p t(!pa  0!p  0!p ,0!p0Q 0)o 9"" $_    ' ,6?GPXbionic/libc/inet/inet_ntop.cfmt.2631$LC0inet_ntop_gp_disp__errnosnprintfstrlcpystrlen !%1>ELSZahov}@Lq=dy     2 6 HS ^ bx  %. X      x     L    , P t T  h d l $ |,  <       ! % , 0 7 ; J N U Y ` d k o v z                            $ + / 6 : A E L P W [ j n u y                             " & - 1 8 < C G N R Y ] d h o s z ~                              # * . 5 9 @ D K O V Z a e l p w {                           ! % , 0 7 ; B F M Q X \ c g n r y }                             & * 1 5 < @ G K R V ] a h l {              $ ( , 8 < @ D H L P T X \ ` d p t x |       inet_pton.o/ 1331265335 1002 1002 100644 11076 ` ELFP4(%" X% RU$ > $ > : ; I $ >  : ;  : ; I I !I/  : ;  : ; I8 .? : ; ' I : ; I.: ; ' I 4: ; I4: ; I4: ; I  4: ;I I&I: ; I.1@11 414141 1 .? : ; ' I@!: ; I"1RUX Y # U$ U% &4: ; I '&I(4: ; I? < (qpint>$T?40'u]5S>L0=nt> v0gy!K!1A 1  A  Q  .l !# )c) )c) 7)c))srcdst{tmptpXch))valwpchn+i,)    )j)Vsrcjdstjj)vallm'mnn)co>pVppqfS f  U> !*3l>  ,)@!afL)!srcL=!dstL"V#@%0 ;FPL[$0k%lx5& .'.Q&, /(f8(J9E(:Z bionic/libc/inetbionic/libc/includebionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetbionic/libc/include/arpainet_pton.cctype.h_types.hstdint.htypes.htypes.htypes.hin6.hin.hinet.h Lp^py,Z  B J N V Z b f m q y }                      # * . = A H L S W ^ b i m t x                            " ) - 4 8 ? C J N U Y ` d k o v z                             # ' . 2 9 = L P W [ b f m q x |                           " & 5 9 @ D K O          $ 0 4 8 < @ D H L P T X \ ` d p t x | ether_aton.o/ 1331265335 1002 1002 100644 5972 ` ELF P4(# % RU$ > : ; I$ > $ >  I&I : ;  : ; I8 I !I/ .: ; ' I  : ; I4: ; I.? : ; ' I@ : ; I : ; I4: ; I4: ; I1RUX Y 1 U411RUX Y : ; I4: ; I 4: ; I? < $-&`9 0;Qint_K10S{B C#  $P c$d%W{5asc5Tq5i7P47PRv7P9@0>HascU"qW89BE:K bionic/libc/inetbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/include/sysbionic/libc/include/netether_aton.c_types.hstdint.htypes.hif_ether.hctype.h5L JKrJKmJKJhJJpJ]mr!!@ $: $ $f$ ,f$,m$f$g$ ,x$/g$g$1!(!H e$!-f$, g$1!(!H e% $<'! $ |   |   $URRR|XX,V<dVVV WDWWW,],<V<]V]hWh T.(ether_aton_rether_aton$<<@`@`ether_aton__uint8_tval0short unsigned intbionic/libc/inet/ether_aton.cfloatunsigned charlong unsigned intaddrval1ether_aton_r_tolower_tab_doubleether_addrunsigned intlong long unsigned intuint8_tether_addr_octetxdigit_ctype_long long intGNU C 4.4.3charshort intlong int/u/raghu/ics_feb29signed char_toupper_tab_u_int8_tGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.ether_aton_r.rel.text.ether_aton.bss.addr.2432.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lpj^p(Z $! np*Oj ! z|` (!|p|0  !0 !p5 $p!p2 !pC( ! pkx !p0\#0? ,oQ a <" J   ) 6Abionic/libc/inet/ether_aton.caddr.2432ether_aton_rether_aton_gp_disp  !%,1>ELZahov}  ,6CHRWaj n~     A      $ (  (       ! % 4 8 ? C R V ] a h l s w                         " &          $ 0 4 8 < H L P T ` d h l ether_ntoa.o/ 1331265335 1002 1002 100644 4852 ` ELFP4(%"8% RU$ > : ; I$ > $ >  I : ;  : ; I8 I !I/ .? : ; ' I@ : ; I : ; I&I.? : ; ' I@ 4: ; I Ijj0;9 int}X10{BGC#  &x & buf&3a 3Qbuf5a  bionic/libc/inetbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/include/sysbionic/libc/include/netether_ntoa.c_types.hstdint.htypes.hif_ether.h&K$3%02x:%02x:%02x:%02x:%02x:%02x<'!'40(!! $ $4!08'<'! $ | xP8H  | xP8H 0x8 TT \U\p` T.nether_ntoa_r$ether_ntoa$xxlong long intunsigned intbionic/libc/inet/ether_ntoa.cunsigned charether_addr_octetlong unsigned int/u/raghu/ics_feb29long long unsigned int__uint8_taddruint8_tGNU C 4.4.3charether_addrlong intdoubleether_ntoa_rshort unsigned intsigned charfloatshort intu_int8_tether_ntoaGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.ether_ntoa_r.rel.text.ether_ntoa.bss.buf.1747.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 #>Lp^pnZ (# npj # z2 x (# (#p< $ #< D#pd T`#p2 # p( #p  #*p0'50>o+;NT$ 4W   (  !-x:CLbionic/libc/inet/ether_ntoa.cbuf.1747$LC0ether_ntoa_r_gp_dispsnprintfether_ntoa  !%,1>ELZahov}  &1 5 AK\   8 0 X    04  4      $ 3 7 > B Q U       asctime.o/ 1331265335 1002 1002 100644 6884 ` ELF< P4('$% RU$ > $ > $ >  I&I : ;  : ; I8 .? : ; ' I@ : ; I : ; I 4: ; I 4: ; I&II!I/ .? : ; ' I@ 4: ; I4: ; I? < H int`:Gtm,->.)# /)#70)#1)# 2)#3)#$4)#5)#6)# n8a#$9#( `C ?O! bufPJ R U wnYs mnZ [ \*tm}}} }*} :}GBf ?v}jfM},}x TG*0r0v bionic/libc/tzcodebionic/libc/includeasctime.ctime.hprivate.htzfile.hunistd.h ,sJ J$@t o$u9tzJ ???%Y%.3s %.3s%3d %2.2d:%2.2d:%2.2d %s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s <'!`'(!C,I`!& G,>s&0'%!  $ !8( ! L,*(% @' !0!8` ! ( ! Q, (T$T!( ! @!@'%@X!HbH%! @0!$! !O$P!@'<'! $JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat | $PX  | $PX < @T@`@x` @U@0b@bHd (d@`dpxd`,c@LcX`cxc T(>asctime_r:asctime$__page_size/u/raghu/ics_feb29yeartm_wdayprivatehidtm_hourtimeptrfloat@(#)asctime.c 8.2unsigned chartm_gmtofftzfilehid@(#)tzfile.h 8.1long unsigned intshort unsigned inttm_zonedoubletm_sectm_isdsttm_ydayunsigned intlong long unsigned intresulttm_minsigned charbionic/libc/tzcode/asctime.clong long intGNU C 4.4.3buf_asctimeasctime_relsieid__page_shifttm_monshort inttm_yearlong intcharasctimemon_namewday_name@(#)private.h 8.2tm_mdayGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.asctime_r.rel.text.asctime.rodata.mon_name.2842.rodata.wday_name.2841.bss.buf_asctime.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 %>Lp ^pZ % npj l% z2|X |% <(%$HpH d % H %ph  %pV , %3p (/ %Fp B  %Tp0 _0 ho  xT&!    $,H8!G L Q V0 "#[enw~bionic/libc/tzcode/asctime.cmon_name.2842buf_asctimewday_name.2841$LC0$LC1$LC2$LC3asctime_r_gp_dispstrftimestrlensprintf__errnostrcpyasctime! ( !%3:AHOV]dkry"0@K O S\fuz<GKWaw ""@ DX \d #` l $  % $  &  '@ HT T` l"" !  <@ @    ! % , 0 7 ; J N U Y ` d s w ~                  difftime.o/ 1331265335 1002 1002 100644 3516 ` ELFLP4(0% RU$ > $ > $ > : ; I.? : ; ' I@ : ; I &I I !I/ 4: ; I 4: ; I? < .qint"/H_9O3a=d?FoT3U } +  } D 0 0 bionic/libc/tzcodebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includedifftime.cposix_types.htypes.hprivate.hunistd.htime.h-D DF! F F |   |  2difftimelong long int@(#)private.h 8.2unsigned intunsigned chartime_tprivatehid__kernel_time_tlong unsigned int/u/raghu/ics_feb29long long unsigned intshort unsigned int@(#)difftime.c 8.1__page_shiftGNU C 4.4.3charlong inttime1doublebionic/libc/tzcode/difftime.csigned char__page_sizeelsieidtime0floatdifftimeshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.difftime.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 t >xLpx^p2Z |  npMj t  z,pD  | d  p p  p p0R0%o7G P L (    bionic/libc/tzcode/difftime.cdifftime !%3:AHOV]dkry   %       localtime.o/ 1331265335 1002 1002 100644 86240 ` ELFxP4(`] ?8P00(X0 P ((0X% RU$ > : ; I$ > $ >  I&I : ;  : ; I8  : ;  I !I/  : ; 5I : ;  : ; I8 !I/.: ;' I : ;I: ;I4: ;I4: ;I&I' II.: ; ' .: ;' .: ;I &I : ;.: ;' I@  : ;I!: ;I "4: ;I#1X Y$1% &41'41(1X Y)4: ;I*.1@+1,.: ;' @- . U/.: ;' I@0: ;I1 : ;2 : ;I3 : ;I44: ;I 5 U64: ;I 71RUX Y81RUX Y941 : 1;.: ;' <.? : ; ' I@=1RUX Y>1X Y?.? : ; ' I@ @.? : ; ' @A4: ; IB4: ; I C4: ; ID4: ; I E4: ; I F4: ;I? < G4: ; I?  H4: ; I? < %M inta;!3|6iyo7^3wodItm,- F.)# f/)# 0)# 1)# 2)# 3)# 4)# n5)# V6)# 8w#$ m9#( ,2 3# \4!# 51# 6# 7# 28# 9# :#$ &;#( !  1 A   )X D *X#)H +A  w# )# =)# V)# w)# + # w#/ T)# )# )# )# X)# )#ats# #% #/ #W #[  I h   1 |6 )# )# u)# )# w#hhminmaxcnum))))-);;f)%%-)~~w)n`M))`M)%~)>)tmMtmpM8}tRRrrwRxXwJCPvc)c;4<W=neg?)$)Qss+wH,.wi/)F8H9;i<)2)t1xt0x {w1|1sp~7lp=i)tmpM8}tspQ))))i){)n  ) ) > tmpM8 }   spdir)i)j)<)liwlohiyw ta !U"num)#6X $l$`$T$H%X&x'#6# $l$`$T$H%&x '(6t*$l$`$T$H%t&xI'V Wr X #6Dg $l$`$T$H%D&x&#6l $l$`$T$H%&x&#64q $l$`$T$H%4&x1&e#6wY $l$`$T$H%&x&(6x`$l$`$T$H%x&x&  x= C! V )J))DOi)"d)"m1)"yy0)"yy1) "yy2)'"dow):  |) y* xX + x,JEdspGd"iH)-|$Zi-B)mi.i"cp7nth/]) 1s 3a0spd !"pU"i)"fid)  )))j1Hq423bufs4u~)5 _)6}M.@4bufľ}63}))"off)74X$F84p$F5L) )) )$ 7Q<%U$c.&oM &{k 7Ql$c.&o '{7Q8$c.(&o '{7Q@$c.X&o '{#Q$c%&o '{#Q ?$c%'o'{7Qxp i$c.'o'{5.8Q1$c.&o- &{V 5#?=7QtC$c.&oi &{| (QE$c%&o '{509I.HV%H 4ts}) Gq   3  (h/)  3 0spdL  ) )K )0 )0)Swk)dwatp1"cp)8)7`$$.&f5!)iwjwkw6l)"im)"jn)7 J$.&m#x$$%'56h/4end0)C1))2 )3a)4.)=O7(P(&$$.h&'7pT$$.&'s(L$$%L'* P  +* +6 +N 0+Z Y&f &q &} y& ' ' & & A& u& & %9 ~9 ~: $B 7+!$U$I$=.&a8$$.''7+<$U$I$=.(&aU8p@$$.X''7+0p#M$U$I$=.&a8`$$.''7np&$$$.&L8$$.' &#,$$%' &#/$$%' '#txAL$$%tx' '#E$$%' '#x{$$%x'#@l$$%@l'(U$$%''/ RDa      0sp 0tmp M`lp))V)G"remw"y)"ip"6\w 4hit)"i)@509))t:;)<)7 lXGB$ 7 <pG\$ 8,E$$.''5)NNw#b$$%'&(,4l$$%,4''r+/6Rx<G 7 \ 8o0tmp9Msp;7<n"i=))>R"t?x) 5"lou) "hiv) ."midy)#!.) HW!NI+J*K.0)a!hR tmpMR;spd*G!+Y!+e!+q)"9}R8H$,H]"o)3}"4bufo#LG$(H(H$  [<G"0tmp#M")%'#=<`&7C\x($a$U.'y'&|#&#9&#&#&$9o9w&3$$m7t$6$*$$.'B8$6$*$$.'B>)?+0tmp1M$<JR$a  $0tmpR%)R-%= 8=`P?vIR  @%<%d<S%  s%<5eP%  %0buf%6aH@Gg%C =h&=<(<%[!0t&"xA&"yj&#,l $%,l'&&'&7l $.'&&'&7'!$.'&&'&8$.('&'&&!'<'!0t'8,@$.X'9U9&S<"MR 'i"  '0tmpR()R<(=,p7G@X"$$$.'}8$=p?mLR"  O(<b(#0tmp9M();(=< >7CP ?#$a$U.@ 'y'&")&V)9&)&)&)9o9w&*$m7` #$6$*$$. 'B8P $6$*$$. 'B>@ # A# $ A # +$ A$hB_H]C[xDexxB$Egmt$66 $ 6-$6)62)6 )#%  65% % )J% 6\%:%F  ) % G_jo%Gk)GlH ;H ;Z bionic/libc/tzcodebionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/syslocaltime.ctime.hstddef.h_types.hstdint.hposix_types.htypes.htzfile.hpthread.hprivate.hstdio.hunistd.he@=K=qWJ@=K"QJ@=K)yJbKJx=K<x=K<K= x=K^Jx=KK$J45KJ5J@?(uU<+uIu>IKKIpxJ JGK$  uJ J[ uHHL0qJJqJMK JqJKIM JQFywJY'MLH7 IKILKLHLHLEOIzJ$<?x+$utJ~0x<GHLJJJJJJJqJJv8~JJJJJJJJJJJ~JJJJ~JJJJ~JJJ   GKIMHKM~KJ~JJLJLGx,I=I=IIv_IIL~KJ~JJLJLK~J=IKIKJ}JKJ}JJLJ}JJy xEvxEuzJKIIK&HQUIvKL=KzQyJLHHLOK>KII;IK=<JINGMGJKK}}JJJHJJJK~JuJK~H0IL<fJKKcJ(LEMKLzJMKLEKM ~}}JJJHJJyJ~0|IIKO~ $MJaJMIzJOJJaJ]JOLILKJJcJMKJoJ8$HL$KKKQLHLJvjJHLNzJLKKLyJ~JJ|}Q=w}Q=KLuL|IIK~II0yKKK$<JlJKdEJ([MJJ~0$YOJC(]J(]JC[MJL[OJJJ?GJU+JFJJt$],$_zRxJJQJ/JKHJtA0J$JJ IKJJn lJM\J~JR<4 QEHuN>$L~4wJ~JK~N=}J wy <oJJoJLv< JJ>HPxJLJPxJIMJzxMJ$J$$J0,Jt=KIRzHgJJHII=JJLGJtJLGJJuJJ0RM$;;I,$$u>]!>}o yJQhM>HuEyR8JIJ<KIJ>HNxw$   yJQt J&, $C! C> $$@> $J$#!@$- $D$ '&$! !(@,$X4'HD$! !(@_$#H#0 7& $$Q<< % 4Q4! &&!H$ $B(q@! PTX\d!(!0`Y$ hXH! %!( LL*xJPTX\`dhk `3'! 0!8%p! *H$< c$'!H$#6& !!.Y$!(@+&!0  !&`+@N!-$Ng+ $*i!y$ '@@! @#P @L+ $M!Y$ '/@!@r`#po!+&!(! !0` !3 !$$! !! !!5! @&>$C! `C>$$@>$T!`#p$$$$$! `'8C#y!0/P!(v$ `kk#Qy!0(!8# h,<'!0'!!!! ' $IHF EB$ihf eDc$DJBjdb $(,40!@!`2@< 1$hhc$d<'!'LHD@<840,(Œ!E$\!B$@d*8c$7H$!  .<E6!~#`/Q <<%5ScV4!$ @V32L`4!h! *LW`!V(!#*@@3&3&*q)@d&GX C #PI !8D#0(!$&8C)#!p#hO!#X3 a !!HkP !@*##!Q!`A!"*3@d&\\LHD@<840,(P''8C)#!pXx!h-Y$h! *L`!XLpX^p7%Z ^ np-^j ^ zhAB ^xE 0^Hx  ^2I08J 8^LL  ^HV ^@^P  ^/gD+ @p^Aox= ^TLrP `^!e`sHa ^#|ux ^%x ^'x h^)y @(^+y< h ^-yP  ^/,z X^1z h^3<| h8^5'| # ^7:}6 x(^9K~G ^;\X ` ^=s`pt\t/t/tt't7t,ExVp R p ^Ng c ^Pupz*q 4^Rp: @^Tp  @^Vp  PA^Xp00vox0_a     (0:`DFxXb/GiAr yCP x/HD!!KE#H#JI\F%B')+,L-/13579;=?@ABCDEFGHIJKLMNPRTVXZ H|$).38M=C[\IR=Y@b?kry% ')"+,<-2:P/BL1R3]5h 7q9x;bionic/libc/tzcode/localtime.cgetsecsgetruletranstimemon_lengthsleaps_thru_end_ofsettznamelclmemwildabbrtzloadtzparseyear_lengthstime2sub.clone.1localsubgmtmemtimesubgmtsubgmt_is_setgmttzset_lockedlcl_is_setlcl_TZnamebuf.4196_tzMutextmGlobal$LC0$LC1$LC5$LC6$LC2$LC3$LC4$LC7$LC8$LC9$LC10$LC11_gp_disptznamedaylighttimezonestrchrstrlenstrcmpaccessopenreadcloselseekstrcatstrncpygetenvstrcpy__system_property_getmktime__isthreadedpthread_mutex_unlockpthread_mutex_locktimelocallocaltime_rlocaltimectimeasctimectime_rasctime_rtzsetposix2timetime2posixgmtime_rgmtimetimegm  @ ` "@#`'rvwxy {@}`~ PPP!O%1P>PEPLPSPZP_PlPsPzPPPPPPPPPPPPP$P2P@PNP\PjPxPPPPPPPPPPPJP^PiPuPPPPPPPPPPPPP*P8PTPcPrPPPPP PP(P7PIPUPPPPPPPPP PP,P>PJPVPbPoPPPPPPPPPPP+P7PPPPPPPPPPP5PRPdPpPPPPPPPPDPbPnPPPPPPPPP P P7 PC PO P[ P P P P P P P     P' L, PE LN  R  r  v   L     L     L P    & P1 L6 PA LJ  N  n  r  { L L     L L      L L    =  A  J LS L^  b  ~   L L P   P L P L P P L P L P L4 LC LS Lc Ls L L P P   L L P   LL P%)2P=LCOHP^LuP~PLPLLPLLLLPP LPDPPOYPePvPOPPLLOOOPLPL(,O=OFLOLZ^OoOxLOOLOOLL+/DHOYOjOsPOOLLOPOOLL L$O-P:O?PMQfPPLPLLPLPLP#L(P3L8PCLHPSLXPcLtPLPLOOLOPLPPPLL&*O;ODLOSimyOPPLPLPLPLOPLOO L+/OEONLY]osLLLLLLLLLLLLLL*8<OWO`LimOOOOLOOOOL%)O;ORVOqOzLOOLL "8<QUko P  L)P4L9PDLSLcLsP~LPLLLLPLOPP LPP- 1OG KOa eOwOOPL    L    P)P5"9"=LFPQLVPaLqLPLPLLOLLOLOPL PP$P0O5P@LHPZPfP~PP##LLLL#OP''L PL)B2'6'L'P'\'`'P,,LLPL,O,OOLLL"L+LFLT,XOxO,OO,,P..LP//LPL,L1P<LE/IOU/YOcPn0r0~PLP22LPLP33LPLLP P 4 4 L' 4+ O7 4; OE PP 5T 5X Lj Lx L L 5 5 5 5 L 5 O O L 5 O!O!L,!50!O=!OK!LT!L]!Ph!6l!6p!L!L!6!O!O!P!7!7!L!P!L!L!P!L"7 "O"7"O7"OE"7I"O]"7a"Ok"Pv"8z"8"P"L"P"9"9"L"L"P"L"9"O"9"O#O#L#L0#L9#LB#L]#Lk#9o#O#O#9#O#O#9#9#P#P $P$P,$P6$P;$PG$>L$P[$Pk$Pw$=$A$P$C$P$D$P$E$P$F$P$G$P %H$%P1%@K%PX%?b%P%P%b%P%c%P%d%P%P ,  tW $  "(#g',./02-3C4s567b8s9aax  aa$ @0@ @@aaX \aa0 C8C< b@ cD d4 =L=d ClC CC CC  C(C$ Q,QL e CC RR f gaah fl h i j k i S SD j g k i T T8 l UU VVV f mW W$WD e` kD XaaH fl XtXp |  YY   t ??   0  n@ D    naa ?? ?(? @@ @@L "P"X D\D CCaa ??h ZZ  @ H @@aa C(C C C| CC$ C(C,C0 < \ bP CdC CC CC0 "8"aa, G4GD DPDH X l DtD ==GAD  AA DD aa( o$ [0[@ FDFP gL ETEh fF AAC CCC   C4C0 8PCTAL ApA CtCx | p EE q \\B BB FF  CCFl C C A$A A<A CDCaa< sL 'P't " t >>x ""4 C8Cl CxC " "l tp "x" u >>aa raa s0 '4'H "T"t tp >|> u >>aa w HHaa x, zaa w4 |aa s, '0'\ t( >h>t uX >|>aa }, C4C0 C8Cl CtC CC CCaa }, C4C0 C8Caa, s@ GDGL DTDP ` t DxD t >> AAD GAD   u >>aa HHaa< sP \`# t >>T ## DDH DTD ##H PL #T# u >>==J $J( 4J8 DJH\J`JJJ(J, \J`"|J#J'J,J.J /(J,08J<2PJT3lJp4J5J6J7J8J9 ( 8 H`, `"#',. /,0<2T3p456789      ! % , 0 7 ; B F M Q X \ c g n r y }                          $ + / 6 : I M T X _ c r v                        " 1 5 < @ G K R V e i p t {                         # * . = A H L S W ^ b i m t x                           & * 1 5 < @ O S Z ^ e i p t                         ' + : > E I X\dhx| "15=AKOaelpw{!%,07;BFUY`dkovz  $+/6:AELPW[jnuy    $ ( / 3 : > M Q X \ k o v z                         - 1 8 < C G V Z i m |                          & * 1 5 < @ G K R V ] a h l s w ~                              # ' . 2 9 = L P W [ b f m q x |                           " & - 1 8 < K O V Z a e l p w {                      !%,07;BFMQX\kox| %)26?CKOX\dhpt  '+26=AHLSWfjqu| #'.29=DHOSZ^mqx| "&-18<CGNRaelpw{")-48?CJNUY`dsw~ !04;?FJY]dhosz~ $(/3:>EIPT[_fjy} #'.2AELPW[bfuy %)15>BJNW[cgos{ !%,07;BFUY`dkovz #'.29=LPW[bfmqx|"&-18<CGNRa e m q                           ! % , 0 7 ; B F M Q ` d k o x |                            " ) - 4 8 G K R V ] a h l s w ~                           ! ( , 3 7 > B I M T X _ c j n u y                             " & - 1 @ D K O V Z a e l p                            " ) - <"@"H"L"\"`"o"s"z"~""""""""""""""""""" " " " " " ") "- "4 "8 "@ "D "K "O "W "[ "b "f "n "r "y "} " " " " " " " " " " " " " " " " " " " " "!" !"!"!"#!"'!".!"2!"9!"=!"D!"H!"W!"[!"c!"g!"o!"s!"!"!"!"!"!#!#!#!#!#!#!#!#!#!#!#!#!#!#"#"# "#"#"#"#)"#-"#4"#8"#?"#C"#J"#N"#]"'a"'i"'m"'}"'"'"'"'"'"'"'"'"'"'"'"'"'"'",",",",",",",#, #, #,#,#,'#,+#,2#,6#,=#,A#,H#,L#,S#,W#,^#,b#,i#,m#,|#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,#,$,$,$,$, $,$$,3$,7$,@$,D$,K$,O$,X$,\$,c$,g$,p$,t$,{$,$,$,$,$,$,$.$.$/$/$/$/$/$/$/$/$/$/%/%/%/%/%/%/-%/1%/@%0D%0S%2W%2_%2c%2s%2w%2%3%3%3%3%3%3%3%3%3%3%4%4%4%4%5%5&5&5&5&5#&5'&5.&52&5A&5E&5L&5P&5W&5[&5j&5n&5u&5y&5&5&5&5&5&5&5&5&5&5&5&5&5&5&5&5&5&5&5'5'5'5'5!'5%'5,'50'57'5;'5B'5F'5M'5Q'5X'5\'5c'5g'5n'5r'5y'5}'5'6'6'6'6'6'6'6'6'7'7'7'7'7'7'7'7(7(7(7(7(7"(7)(7-(7<(7@(7O(8S(8b(9f(9n(9r(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9(9)9)9)9)9")9&)9-)91)98)9<)9C)9G)9V)9Z)9a)9e)9l)9p)9w)9{)9)9)9)9)9)9)9)9)9)9)9)9)9)9)9)9)9)9)9*9 *9*9*9*9!*9**9.*95*99*9B*9F*9M*9Q*9Z*9^*9e*9i*9   (08@HP X"`#h'p,x./023456789  $(,04@DHLX\`dptx|(,04@DHLX\`dptx|  $048<HLPT`dhlpt $(,048<@DPTX\hlpt(,04@DHLX\`dptx|  $0 4 8 < @ D H L X \ ` d p t x |               """"""""""" """ "$"0"4"8"<"H#L#P#T#`,d,h,l,x,|,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ,$,(,,,8/</@/D/P/T/X/\/h4l4p4t4444444555555555555555555555555(5,50545@6D6H6L6X6\6`6d6p7t7x7|77777777777777777777777 9 9 9 9 9 9 9$ 9( 9, 90 94 9@ 9D 9H 9L 9P 9T 9` 9d 9h 9l 9p 9t 9x 9| 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9               $ ( , 0  4  8 "< "@ #D #H 'L 'P ,T ,X .\ .` /d /h 0l 0p 2t 2x 3| 3 4 4 5 5 6 6 7 7 8 8 9 9strftime.o/ 1331265335 1002 1002 100644 29140 ` ELFXAP4(0-8?HH(% RU$ > : ; I$ > $ >  I&I : ;  : ; I8  : ;  : ; I8 I !I/ .? : ; ' I : ; I.: ; ' I : ; I.: ;' I@ : ;I : ;I: ;I : ;I4: ;I1RUX Y11X Y11X Y.: ;' I : ;I: ;I 4: ;I!.1@"41 #.: ;' I@$4: ;I% &.: ; ' I@': ; I(: ; I): ; I * : ;+ U,4: ; I- U.1RUX Y/ 04: ;I11 24: ;I 3&I4&I5.? : ; ' I@64: ; I74: ; I 84: ; I9!:4: ; I? < 2 intA;>7H6ib k7^tm,-_ 7.)# A/)# 0)# 1)# 2)# 3)# Z4)# 5)# [6)# p8w#$ *9#( S  monT # U #0 V #` W# X# Y# NZ# T[# am\# pm]# ^#  , Q(H)Sc))oc)+)c)@)c)P") LstrTptV")?c)~Soe7Io78TISe-n-pt2 buf7) G !! 4R" `#d\pa-b--Z- ptV")$)$)Y0cXwne\%X" PhHwne\%" P&%T - 'Ů(t- J(ptǨ'6)@ '"F j*H+`,")-x$2R)7$}S.-$)$;)3$)$)w) w/+0len)nbot)top) / d0)dp1Uph"*W eZ1U-t$.) /2tm2bufU  mkt,@L(1Ud>  M? 1Uqo 1U1 1U, 8 8 1UD P k 1U 1U2 8 3tm)L 4_ e 5a0# (s2D 'z m ' (t- )"F 6p 7)X05P08 ? (s21 'z D 'W (t- j O 8? p n 8e^ &8 } 8  *7@L  9:j : ;: ;:8:39 # P:): o bionic/libc/tzcodebionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinestrftime.cctype.hstddef.h_types.hstdint.htime.htime64.hprivate.htzfile.hunistd.h$Im{yJJ{J HKyJ{J{%I{HgI{H$u0duytzJR{ u({ um(Izn< Lp!^p96 Z 4N(. npoj \U0. ~z U8. X U(.2\ U.T  V.@( \Y.,* 4]H.,+8 |](.d+ ].+pD,' d_`.<-8 _0. Jp-} F _."Ypq9/U n.$mp9Hi n8.&p9@| Dn.(p0(<Z0?o??H/7 L    $*\1T 6 "$&(*D\JO TY^chTnhtlz$xH4<@0|+, 8bionic/libc/tzcode/strftime.c_add_conv_yconv_fmtC_time_locale$LC13$LC5$LC3$LC0$LC1$LC2$LC4$LC12$LC14$LC15$LC6$LC16$LC19$LC11$LC8$LC9$LC10$LC7$LC17$LC18$LC20_gp_disp_ctype__toupper_tab__tolower_tab_snprintfmktime64tznamestrftime_tztzsetstrftime  @`>@ !%1>ELSZ_lsz '5CQ`z-9Uq  %*8CQZ ^t x      L P Tajs| "-6:Thl %/<JOY^lv{#(3AJNhx/3[douy   D H t x       M g r v z                 # - : P Z o y            ) | o  77 8 9 : :t 977( ;P \ 77   ;@ D    ;   !!  "8" "@"D #L#P #X#77T `X d\ h h p   $$  h " " ""< #x #D# "x"  <H ;@ %P% && "" '' 0 (8(d )h)l |  ** " "  +,+T #\# ,, ""   --  8 @  P X  . .    / / 0 0p = $ $  " " 1 1 *, * #H #         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                            $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                            77 ?T t 22 77 >           $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                          $( DHpt ( Ht      ! % , 0 ? C J N U Y ` d k o ~                      ! % 4 8 ? C R V ] a pt| "&-18<CGVZbfmqy}%)04;?FJY]dhosz~!%,07;JNUY`dkovz #'6:AELPW[jnvz$(7;BFMQX\cgnr  $37>BIMTX_cjnuy  /3:>EIPT[_nry}    # ' . 2 9 = D H W [ b f m q x |                         # ' / 3 D H O S Z ^ m q x |                        ! 1 5 D H W [ j n   (08       $ 048<HLPT`dhlx|  $048<@DHLPTX\hlptx|     $(,04strptime.o/ 1331265335 1002 1002 100644 14884 ` ELF!P4()&(% RU$ > : ; I$ > $ >  I : ;  : ; I8 &I I !I/  : ;  : ; I8  : ; .? : ; ' I : ; I.: ;' I@ : ;I : ;I : ;I4: ;I .: ; ' I@: ; I4: ; I4: ; I : ;  : ; 1RUX Y 1.? : ; ' I@4: ; I 4: ; I!4: ; I "4: ; I? < gGint;aN\S0s|7tm,->.)# /)#0)#1)# 2)#3)#4)#5)#6)# 8l#$(9>#(D >Y >i  .&/Y# day0Y#1I#8 mon2I#hm3#4>#5>#6>#t7># > \.])#^)#)Jc))bufT,U!)))Y")X I)o<bufo]fmto>ptmocrocqIzbpr2lens0 t)it)1.|@I&ODbuff>4fmtf>GtmfZcrhp   =!83 i"8>"f9RX P":Rv  bionic/libc/tzcodebionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includestrptime.cctype.htime.htzfile.hstddef.hyJIKKLIKK3<MJ3JMJPJJ~J\JJPJ~JJ JJQP6JJNJ~JxJJ~J\JJPJ JJQPR.JJ~lJ=JptwJIK},ytNxJ}0t~<~<Cux$JJJu$LCux$JJJ$Kwu~~~xIKIL~~~JgIK(~?~$LrxKKHL Cj$I1 (-$ff Lp^pkZ |*' npzj -' z 28 D|  4-'$T L.'xD 0 ' 1`'pll t20'l 2'#pDm 2'2p. 9'Fp0B 9 'Yp8U 9P'!gp08/r0g{oy|'`(! )    )3!#FK PU $%Zckr~Dbionic/libc/tzcode/strptime.c_conv_num_strptime_DefaultTimeLocale$LC0$LC3$LC2$LC1_gp_disp_ctype_strlenstrncasecmpstrptime  @% !%1>ELSZahov}"0r 0KW [ u   (5CRWansy ~ #/9F^ a e!!< D "P T  X  t | # $ # $h p # $ # $   8 D8 #P $ @ #T $       $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |          $ ( , 0 4 8 < @ D H L P !! (          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |              $( X\ ( \     " ) - < @ H L ] a p t {                            % ) 0 4 ; ? F J Q U \ ` g k z ~                              # 2 6 > B K O W [ d h p t }                          # ' . 2 9 = D H O S Z ^ e i p t {                             ! ( , 3 7 > B I M T X _ c j n u y                        $48GKZ^         $ (,__set_errno.o/ 1331265335 1002 1002 100644 3668 ` ELF`P4(# (% RU.? : ; ' I@: ; I$ > .? : ; ' I@ ~A M-T<Tn T int-,T,n,T>V bionic/libc/bionicbionic/libc/include__set_errno.cerrno.h uHL ,~ <'!'$ $D('$<'!(@! #  | <P(D , | <P(D ,,<( T0<T $T6)__set_errno[__set_syscall_errno$<,<,__set_errnobionic/libc/bionic/__set_errno.c__set_syscall_errnoGNU C 4.4.3/u/raghu/ics_feb29GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__set_errno.rel.text.__set_syscall_errno.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp`^pZ x! npzj T ! ~<z d ! <, | !ph8 !8 !pQ P!p): !pc( !p 4 !p0` 0)o%9 " x S   "< .7?,bionic/libc/bionic/__set_errno.c__set_errno_gp_disp__errno__set_syscall_errno  !%+6 : > O ]h l | c w     , 0  0      $ + / > B       cpuacct.o/ 1331265335 1002 1002 100644 5652 ` ELFT P4("% RU$ > $ >  $ > : ; I I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' I@: ; I4: ; I4: ; I4: ; I 4: ; I? < I intcBdqWs a>0 C]e/NEW X# Y)#>Tw _px# _ry)# _wz)# L{E# m|E# _bf}# ~)# :}# 6'# LG#$ g#( 3#, _#0 _up#8 _ur)#< #@ #C _lb#D )#L =#P )' } )G } )- g } )M ) }  ) m>>RS"),uid"!$)4fp%]buf&"2O00 bionic/libc/bionicbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includecpuacct.cposix_types.htypes.hstdio.hunistd.h"(uIu =@pKIAIGM/acct/uid/%d/tasksw+<'!'|xtpl'!8$!  P$! %& !@@!@0$ !(@ ! @@|xtpl's&!`!  $ @/$b!  %&@!@ C|#xtpl' |  ,PT |  ,PT, @T\ccchpbpRbRbMcpuacct_add,,__page_sizeoff_t_sizecount__kernel_uid32_tfpos_t_close_offset__sbuf_readFILEfloatuid_tunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEdoubleunsigned intbionic/libc/bionic/cpuacct.clong long unsigned int_seeklong long int_baseGNU C 4.4.3char/u/raghu/ics_feb29_write_cookieshort int_flagscpuacct_add_extlong int_file__kernel_off_tsigned char_nbuf_lbfsize__page_shiftGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.cpuacct_add.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pMZ  npj  z2, p p4 $ <4 4 pp < p "  p.   pN  p0^0 o * *! g    # (,4=FLRY_bionic/libc/bionic/cpuacct.c$LC0$LC1cpuacct_add_gp_dispsnprintffopenfputcfclosemkdir__errno !%3:AHOV]dkry)7Sao}       3@ , ( 8T Xp    @         ! % 4 8 ? C J N ] a h l s w ~       arc4random.o/ 1331265335 1002 1002 100644 17628 ` ELF%P4(308((0 (% RU$ > : ; I$ >  $ >  : ;  : ; I8  : ;  5I  : ;  : ; I8 I!I/ .: ; ' I 4: ; I.: ; ' : ; I: ; I I.: ; ' @4: ; I : ;  : ; I4: ; I 1RUX Y 1 U41411RUX Y .? : ; ' @!: ; I": ; I#.? : ; ' I@$4: ;I%1X Y & '.? : ; ' @(4: ; I )4: ; I? < 9|0intY;h<0T&Oz4;H u1I_5i`") 3:4H8cdtTYv;y{W_#4# )n*n# )+W z; i<## j=## s># ##si#sj#InK)fT4datT4T)nV)siW#-Wval#e>ih)!fdh)4itvj.rndk>l~nm) ( ~)Pxp N \!u"n0buf4<Z#  qxval:p0K P(T X  p3F#Y!y$r$min D sd"dat4!)%L &L :)M' r\`##val#l-0sA)(rsB~CoD)) ;) ;< bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxarc4random.cstddef.h_types.hstdint.hposix_types.htypes.htime.hpthread.hstdlib.hunistd.h (=K W)JWJ)JWJ)WJLHLKIK=~FJyJQ:J JuJ Ju JrJrJJHLKIMQ_IKJK$J^%JIK 4LHzRLHLJJJJG?$=F<8Lp84^pl=Z 11 np @j d681 z2   61\ 71\ L81$ 91 91 \ 9H1%$! 91:J^fyp |:p1! :81#p $;1%p ?1'p`P ?@1)pp L?1+p0 0"o""-`2( `0   !+:=K V !#%')+-a ./foty\\ bionic/libc/bionic/arc4random.carc4_stirrs_initializedrsarc4_stir_pidarc4_count_arc4_lock$LC0_gp_dispopenreadclosegetpidgettimeofdayarc4random_bufpthread_mutex_lockpthread_mutex_unlockarc4randomarc4random_uniformarc4random_addrandomarc4random_stir__arc4_getbyte .@1`2345 """!!%1">"E"J"W"^"e"j"w"~"""""""""""""""""$"/";"I"`"t"""""";"X"_ c gx" !! ! !# '!.!7P"W[_h"r!!"!!!!"-1!<!ENY]!h!qz!!"""")26GKT]f"mqu{"!!""" "#"0" ((( ,< )8 #H#P` *| + ,  X l4 \  )  ## -((8 /@P T` ,p t| \     , 04 0((( /08 <HL PX ,\  ` t 0xp | h$ l ((T 1(($ /4< @L TXd 0   (( /(0 4  DH 0(($ /,4 8DH LX \ p 0tT xl   8<dh <h    ! % 4 8 ? C J N U Y ` d k o ~        ")-<@GKZ^eix|  $37FJY]eiy}   '+:>MQ`dlp  (08@        ( , 0 4 8 < @ D P T X \ ` d h l x |                $048<@DPTX\`dhlptx|  $(,048<@DHLX\`dhlptx| $0 4 8<@DHLPTX\`dbasename.o/ 1331265335 1002 1002 100644 3872 ` ELF P4("t(% RU$ > $ > $ >  I.? : ; ' I@: ; I4: ; I 4: ; I &I\2intEm |h&% v' ret() }T bionic/libc/bionicbionic/libc/includebasename.clibgen.h%Kz=FN<'!'$  !!  $ @$ (' $!(@@$! (' | P(L | P(L( 0T0Pa\abasenamelong long intunsigned intpathlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3charlong intbnamedoubleshort unsigned intsigned charunsigned charfloatshort intbasenamebionic/libc/bionic/basename.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.basename.bss.bname.1844.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 p  >xLpx^pZ x npj H ~dz P@ p0  $0  pTI P p  p   p  p00o(p !  N   * 3<Gbionic/libc/bionic/basename.cbname.1844basename_gp_dispbasename_rmalloc !%3:AHOV]dkry   a  $ 0 H \ t         $ + / 6 :    basename_r.o/ 1331265335 1002 1002 100644 5672 ` ELF P4("0% RU$ > : ; I$ > $ >  I.? : ; ' I@: ; I 4: ; I 4: ; I 4: ; I : ;  &II!I/ I`1int;D5)5"5  "j"0 [$5 $5 len%)q %) &@ B;  bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includebasename_r.cstddef.hlibgen.h"$P=IK$IMXKJrJJxtstzxLpx^p:MZ 8 npj P z2  XP p0  0  p @ p!  p   p#  p030K o] m )! U   ! & +6?FNbionic/libc/bionic/basename_r.c$LC1$LC0basename_r_gp_dispstrlen__errnomemcpy !%1>ELSZahov}          *0  <    8          $ + / 6 : A E L P W [ j n u y                           ' + 2 6 = A H L S W ^ b q u |               clearenv.o/ 1331265335 1002 1002 100644 3084 ` ELFHP4(! % RU$ > $ > .? : ; ' I@ 4: ; I I4: ; I? < ~T9int0!)DaP#agm+LaZ4 bionic/libc/bionicclearenv.c!IJ <'!B@!@B$C`! |  D |  D<R7clearenvDDbionic/libc/bionic/clearenv.cunsigned intcharclearenv/u/raghu/ics_feb29environGNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.clearenv.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 , >xLpxn^pZ 4 h nph^j  ~Dz  p   ,  pL p_ p~  p p0`0o 0p    9   D (1bionic/libc/bionic/clearenv.cclearenv_gp_dispenviron !%39D H \ puA          dirname.o/ 1331265335 1002 1002 100644 3864 ` ELFP4("t(% RU$ > $ > $ >  I.? : ; ' I@: ; I4: ; I 4: ; I &I\|2intEm h%% v' ret() |S bionic/libc/bionicbionic/libc/includedirname.clibgen.h%Ky=EO<'!'$  !!  $ @$ (' $!(@@$! (' | P(L | P(L( 0T0Pa\adirnamelong long intunsigned intpathlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3charlong intbnamebionic/libc/bionic/dirname.cdoubleshort unsigned intsigned charunsigned chardirnamefloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.dirname.bss.bname.1844.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 h  >xLpx^pZ p npj @ ~dz H@ p0  $0  pTI P p  p   p  p00o'l !  K   ) 1:Dbionic/libc/bionic/dirname.cbname.1844dirname_gp_dispdirname_rmalloc !%3:AHOV]dkry   `  $ 0 H \ t         $ + / 6 :    dirname_r.o/ 1331265335 1002 1002 100644 5336 ` ELF P4("8% RU$ > : ; I$ > $ >  I.? : ; ' I@: ; I 4: ; I 4: ; I : ;  &I#Sint-;fA4)4" "T9"0 }$ %) len%)/ D! z bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includedirname_r.cstddef.hlibgen.h"(O=IK$IKNap =I<;jpJJ./<'!'40,($!@!>@ Q$!+ `%/$4/$'/1&0"0/$1&+`#x0-1&%.*5 @! *&%`!  !(! @ !0 !Q@4!`0,($8'+/ $j$'/$)#1&+@ $"$X$$& $N$F4 |  P8T |  P8T8 LTL` `` 4U4b U b DVV V0@VltVVTa 8a@laa ccca8@alaa'dirname_rlong long intbionic/libc/bionic/dirname_r.csize_tpathbufflenlong unsigned int/u/raghu/ics_feb29long long unsigned intendpGNU C 4.4.3charExitlong intdoubleresultshort unsigned intsigned charunsigned charfloatshort intunsigned intbufferdirname_rGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.dirname_r.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 ` >xLpx^p'Z h  npD~j  z2 X p|4  4  pc  pG   pg   p  p0 0o(<!  S    % *4=DLbionic/libc/bionic/dirname_r.c$LC0$LC1dirname_r_gp_dispstrlen__errnomemcpy !%1>ELSZahov}           @    0 < <         $ + / 6 : A E T X _ c j n u y                           / 3 : > E I P T    drand48.o/ 1331265335 1002 1002 100644 3212 ` ELFP4(% RU$ > $ > $ > .? : ; ' I@ I!I/ 4: ; I? < e;intNv)qooL}iS bionic/libc/bionicbionic/libc/includedrand48.cstdlib.h <'!  |   |  drand48long long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3charlong int__rand48_seeddoubleshort unsigned intsigned chardrand48floatbionic/libc/bionic/drand48.cshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.drand48.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 l >xLpxo^pZ t  npmj $  ~z ,  p,  L L  \ pl d p  l p | p00o  $ E    &/7bionic/libc/bionic/drand48.cdrand48_gp_disperand48__rand48_seed !%3:AHOV]dkry  `         erand48.o/ 1331265335 1002 1002 100644 3668 ` ELFP4(!\P0% RU$ > $ > $ > .? : ; ' I@: ; I I)XintkFno LxS bionic/libc/bionicbionic/libc/includeerand48.cstdlib.h$HL4KGG<'!'(  !D$ ! F FD$ !F FD$4F !F( F 0' | $P0P5476 | $P0P54760 0T0`erand48long long intunsigned intunsigned charbionic/libc/bionic/erand48.clong unsigned int/u/raghu/ics_feb29long long unsigned intxseedGNU C 4.4.3erand48long intdoubleshort unsigned intsigned charfloatshort intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.erand48.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxf^pZ  np|j  ~z 0 p8 8 p4> @pr ,p  4p Dp00o    @    &/:bionic/libc/bionic/erand48.cerand48_gp_disp__dorand48ldexp !%3:AHOV]dkry    ` $ @ `          $ + /    err.o/ 1331265335 1002 1002 100644 11256 ` ELFP4(0-(0((0(0(% RU$ > $ >   $ > : ; I I  : ;  : ; I8 : ; I8 ' I I&II!I/ .? : ; ' @: ; I4: ; I4: ; I : ; I4: ; I .? : ; ' @!4: ; I? < EVwjint1P Q(} aC#N 1W ?X# YE#0 Tw _px# _ryE# _wzE# t{7# |7# _bf}# ~E# b# *"# EB#$ %b#( V#, #0 _up#8 _urE#< #@ #C _lb#D E#L 8#P E"  EB E( b EH E  Eh00Kof@fmtx apx>{<\Ffmtj|apjlE>D}fmt`apb@:DfmtVapX+81LEQfmtLoapL64@2Efmt2ap44Eberr24k(Efmt(ap*]%)O bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includeerr.cstdarg.hposix_types.htypes.hstdio.herr.h$KKu (GMu; wKFK wKFK (KKIKu= 2wKFK<,Gu, (wKFK%s: : %s <'!'$ !F!$ & !( !0@ &&$  $ ('<'!',($ ! !Qf$ &@!(@!0` &$$$ & ! &$,($ !0@ 0'<'!'$,',04 !(@$('<'!'$,',04 !(@$('<'!',($ !!F!$ & !( !0` & $ & ! @<'!'$0'04 !0@<'!',($ !! !Rf$ &`!(`!0 &$$$ & ! @&$ !0@ ! <'!'$0'04 !0@ | P(P P0TDP(DDP(D P0T4P(D$P0X4P(D | P(P 4P0TXDP(DpDP(D P0T4P(D$P0X4P(D( DTDa 4U4|b0 8T8b 8U8c@aD( 8TD( 8T0 LTLb 8U8a DVDc4( 4T 4U0 @T@a @U@c @V@d4( 4T 4UZvwarnxvwarnFwarnx}warnverrxerrx@verrerrTDD44DD44off_t_size__builtin_va_listerrxfpos_t_close__sbuf_offsetwarn_readFILEfloatbionic/libc/bionic/err.cva_listunsigned charlong unsigned intshort unsigned int_blksize_ubuf__sFILEverrdouble__progname__gnuc_va_listvwarnxunsigned int/u/raghu/ics_feb29long long unsigned int_seekverrxlong long int_baseGNU C 4.4.3char_write__sF_cookieshort int_flagsvwarn_extsverrnolong intwarnx_fileeval__kernel_off_tsigned char_nbuf_lbfsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.vwarnx.rel.text.vwarn.rel.text.warnx.rel.text.warn.rel.text.verrx.rel.text.errx.rel.text.verr.rel.text.err.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 ("@.>XLpXG^pZ h". np-j x%@. z2   %H.l  &.L D &. D &.  &P.h 4 '.  '.| 4 '. p  '. 8(@. (p$ x(."7pa^3 (+.$KpXG 0+H.&^pHZ x+.(lp0_w01oCSd /  !    "$&(*  $ +,)09DIQZ`fnu~DD44bionic/libc/bionic/err.c$LC0$LC1$LC2vwarnx_gp_disp__progname__sFfprintfvfprintffputcvwarn__errnofwritestrerrorwarnxwarnverrxexiterrxverrerr '@+`,-/01 !%,3:AOV]dkry$2N\jx     $27AHO S Wj   -BIMQZds\ y   !!$ "( #4 $0 @T %l &!!( (@ "D #L $H Th % )  * $ !! !! '!!( ", #8 $4 H\ %t & .!! -!!, (H "L #T $P \p % )  * $  .!! 0 48 X\ pt  8 \ t      $ + / > B I M \ ` h l |                     " 15=AQU\`osz~ /3:>MQX\kow{   ( 08@H        $(,048<fdprintf.o/ 1331265335 1002 1002 100644 4856 ` ELFP4(# 0(% RU$ > $ > : ; I $ >  I&I .? : ; ' I@ : ; I : ; I 4: ; I 4: ; I : ; 4: ; I4: ; I? < Mint`;q) w"Et fd"E "> ap"}Q buf$h ret%Edend,d 0E@n fd0E 0 ap2}ret3ELL bionic/libc/bionicbionic/libc/includebionic/libc/arch-mips/include/machinefdprintf.cunistd.h_types.h"GKLu?0xKEK <'!',(! ' @!0@ !   ,(0'<'!'$0'04 !0@$(' | tP0H@P(D | tP0H0@P(Dt0 (T(l` 0U 0V8LRdhR@( 4T 4U)vfdprintffdprintf$t@t@long long intunsigned intunsigned char__builtin_va_listlong unsigned int/u/raghu/ics_feb29long long unsigned intvfdprintf__page_shiftGNU C 4.4.3__va_listcharlong intbionic/libc/bionic/fdprintf.cfdprintfdoubleformatshort unsigned intsigned char__page_sizefloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.vfdprintf.rel.text.fdprintf.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 0!>Lp^pxZ @8! npj x! ~tz (! 8@ !pxD  !D !p !p- !p( !p  !p05"0Woiy, " P   t )2<BG@bionic/libc/bionic/fdprintf.cvfdprintf_gp_dispvasprintfwritefreefdprintf  !%,3:AOV]dkry~        ' + / A FP o|   8 T    0 4  4      $ + / > B Q U d h o s               fork.o/ 1331265335 1002 1002 100644 4016 ` ELF P4(! % RU$ > $ > $ > .? : ; ' I@4: ; I4: ; I? < r;intN)~6)ret$) 0e0xP bionic/libc/bionicbionic/libc/includefork.cunistd.h* s< <'!' $  @!@  ! @ ! ' !  ! ' | P H | P H LT`T`R``R`forklong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charlong intdoubleshort unsigned intsigned char__page_sizeforkfloatshort intbionic/libc/bionic/fork.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.fork.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxn^pZ  np|j  ~4z P p, $, pP_ pp p  p p00o H   (     )B^elxbionic/libc/bionic/fork.cfork_gp_disp__timer_table_start_stop__bionic_atfork_run_prepare__forkgetuidcpuacct_add__bionic_atfork_run_child__bionic_atfork_run_parent !%3:AHOV]dkry    ]  , < T d t           $ + / 6 : A E L P    fts.o/ 1331265335 1002 1002 100644 39496 ` ELF`^P4(2/ ((x08% RU$ > : ; I$ >  $ >  I : ;  : ; I8 I !I/  : ;  : ; I<  : ; I.: ;' : ;I4: ;I: ;I4: ;I.: ; ' : ; I4: ; I.: ;' I &I.? : ; ' I@: ;I: ;I: ; I 4: ; I!4: ; I"4: ; I#1X Y $1% &41' U( : ;).1@*41+41 , 1-.: ;' I@.4: ;I/4: ;I04: ;I 1 : ;24: ;I 31X Y4151RUX Y61X Y7 : ;81RUX Y9: ; I:4: ; I ; : ; < : ; =1RUX Y >1RUX Y ?' I@IA4: ; I? <  HintS;8"6ic8{,Z7^`8p${%;*8=@uW9h -5 y .#  /5# 0 1{# x 3;#  4;# k 6# q 7#$  9#(  :5#, T #@ L ?#D  A#H E B#L  D#P  E#T J G#X  H#\ J{#` E   5 \ 6# n 7#  8W# b 9I# :#  DIR =DIR(&O i't# (t# )z# 5*# Z+# 1,)# -0# .)# /# <)#$}H't @t# At# Bt# FC# D# E# ZF# G)# H)# I0#$ aJ0#( L#, 5M#0 N#4 SP#8 =bW#: fW#< 'lW#> sn#@ Eo#DOt) FTS=  pOUp$sp$Up3C`sp$plen0cp0len0max0z)Xsp$ p3)Fv)Ysp$y !p!rfd)"})#z$%&'");sp$pZ)tdevinosbpsb)(err2)Ny$o$$* &&*)+*],-)hsp$pfd)%.ret)/r)/N)0sb1i `-[(Usp[$uU[>[).ap]H.p]%(.agz~sp~$~~0plen0)& sp$*0p-| p sp$+)p.dp!p p"/U";.cur#K2# /q$v /% .len&0 2v&00/>') 2'),2')2m')$/t')b 2 ')82/')4/() .cp) 1Q3  444% &*@ 3d 44%d* S *f 5h! 4 4 '8& 3J 4%&6`4%`&E8u sp$ ) .pC .fd) 6$ %&y!  sp$A .p tmp/)K.t/)17Eu3,1 $%,&3d|; $<%d|&8*PXk4A47'p&J*Uebw$9F9F)\9G:spI$pJ"J">K)P L:tmpL!lenM0;Q;VH<[#`c4r%&~*=`c34r'&~*=<c\4 4 '& =8g444'P&*=hx484/4&'*&&*%+~*,(=s*444'&*# e444% &*> 4'0&?)@@A7 ;A ;  bionic/libc/bionicbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysfts.cfts.hstddef.h_types.hstdint.hposix_types.htypes.htypes.hstat.hdirent.hunistd.huIL}E  $ zIMKzKFNlt[J%J$Q<<Gt KO&<[J%JX<u#VKILLHL K}uKqu(EOu J=tv mJJtJAxq $vJ JvJ JIJ=JJJuvLnKKDuK <PnJJ tJ 4wJ JuJJ=IKJyJQKxROt JuJ u=u$<~JJ~{LK{J$zTK JK~Kt=KLKIKJu=IKxLH%D $VILIIKILJ ~KILmKIK)IKNEN'KKIL<x<4FN=KKL4JLJ=yt4yJJDLIKI8JHJGKFKLKyMGMzJzJtKGLKFKKL=ytHJJyJKJzt<z JiJ#KIKGLKFKLKz JvJK J GuwKO=IzJKILLL K}JKV=z ' $C '$<'!'$ !$D 8@!! P ! $D06`$DD!   D  D ! @$ !  !@! P  $P ! ('P$!!  ('<'!p'$C0`!'B0@2 !( @&@$0=E.$42PD8$$ d'@ !( R @! !( h$ $' !( @ D $ @ $%$0)D4 ,8Q!$B8_ ,R0X$$E @Ǧ!XIi% $$*@߮D&!0! @!(  ! 0+`M$! ® 8ͦ!XL+l:$ˮ,(( $:ŦĮޮ  R& ! `@!@ ! `4"@ @DDS$G#0!fVCB@! 8J@DE$DI#!@HD?C!8JADE$$2 `D l@<<M$<<D @$ @8Q$24C@@ $_! !( !0@tplhd`\XTP9% x'@$#Q<7 <! `S ,$D!0$ŀ_$/8~0!  / $!@B% <h8$“Ga@$ I1 ̮! !(Y$ !0(]:¦X$3-$VE('S (!R&S %!!(+pU !  N$R ! R  ! !   ! `$ 36$: $R!t! plhd`\XTPx'$1`Ž $®:ߦ $:Ħ׃ؗ R ! g@$0<$4 $#HY! 0® 8ͦ!XL+l$ˮ !  ! ! @ @ ! `$ 5$: $tN$!Pp! lhd`\XTPx'$!C<4!`ˎ(Ԏ<ˮ &4$8!D ,B4 i0  #B@ $?j $8D, D @$$ 4:$Z! V$$O!:L!&! y& $@$!!@$b$ :D!3 $8<'!',($ !$  $C!,($ 0' @$ 0:B $F,B($ 0'$G,!($ 0' $!   $$$8K `/ $Ń!( $O2 !( 9& ! $ I5$ '!( !0@!@!( ' !  ! @@ ! @ ! @!<'!'40,($ !! 4!0,($8'$ C0T`$>#$p>%$.f:%$R$0!  !8>S $JG$h&!Xj/$/I9 !F($D$ D&4P!0,($8':%$(1-!( Y% $P:"$Kd1! %!( !0@ "<2! O6</4!!0,($8's@X00# _<"E0D $ ! @$:&! DG0 $$@I$H!  @! @Y% $!@@B@$O 1a4_! 3 ! 8m$_$x!x8n`$E0`n$ $ :pSC!`$_3` D@(D&DF$!(  $!  /$@q"G$! !@!  F$(H0  IP!( Y$ !0:"! ! @!(% $ $K:$(>$Q$2$%!( !0o@ <$7<><bF08I0$G0@  dg@  dn'! @!( % $@P@  $C <,KC5<$+^`!` !`@&Hi eg%! @Y% $`@$DS 4$L DW@$D$E! 4$C ! ` @@ ! N $.:- O$$:>  dQ  Q$HS 5j$S<'!@'$$!!@! $D'$ ($!@@2 ^$P6$P<`! `!! 1&$+0 F&,.!! ` 1&3+@` HJ&K%!(p+H% D  @N $L! @ 'J$K%!(p+H D E9@$Q$/2H $ hB!  @! @ !($WV$2>`(I$$$_@$`8d'!! ! `@!@$HF$HP$1 !  !@@! @ !($LK $1 ( > !I&$$h@ D&!(`!0  ! $BQ08S X0S!  !( Z@$@$0q_4EX8$$ 8!`:b!&`& *!(! @& !0!@$DH$0$ !  !@@! @ !($BG$F0>(I & $$@I@ $K0: `P X0@!  !( @ B !( S /@! !( h$ $:OP%$0'D.$46,8N$B8QW ,O0V{$y $ @r $ $U ! !   DE xLpxN^pZ k( 0 np j uH0 ~ Xz u0 x vh0 xvH0"h vX0h#( w002$$|  Hwp0 . x0!0 8yh0460 z80Gp=\C {0 X?\T h|H0"fp`@b |00$up?TWq 0&pT` P0(pT 80*p0W0m\o\\0f1$  j   #h6(?|  "$&(*,IN-.SX [dlv{ bionic/libc/bionic/fts.cfts_statfts_safe_changedirfts_sortfts_build$LC0$LC1fts_set_gp_disp__errnofts_closefreefchdirclosestatlstatmemsetfstatopenqsortreallocopendirdirfdreaddirstrlenmallocmemcpyclosedirmemmovefts_childrenfts_readstrrchrfts_opencalloc$ '@ ` :;= !%1>ELSZ_lq~ +9GUcq 'FSao} %3AP\jx .<JXf+as    ,;@JS W fk o {  +4=FYkt z   +/3FKV[fu ' 3 7 ; N S ^ m |               ( 3 8 G V a p u |               & * ; ? O S ` d ~                  & 4 E P ^ c n s z                  ! % . 8 = G L V r |               -8<Qae$/3MQ_jnz  1  Q2%%4 &%%\ (h ( ( ( ( ( ( ) & *0 &%%@ + & , - ,( &L &%%D .` &x *| & & & & )@ /%%D 0\ 0 1 (%%@ 2 3  < 4p 5 6 - 7  5D 5 4 8 ) ,H &P &l 8   ( & & ( ( ( 8 & 4 & 1$ 5T (t ( 8 & 9 (     P &%%4 &d & ( (P Tx /H |  ) * *%% ( 9L T  /|  * (h (  (  )< )T 9x < 5 9   D /@ H * ) *P   &l xp   ( & & &H &\ *p &%%T & > 5 5T 1` (p & ( 1 64 - 5 6 -4 7x +   6@ - ( , & & ,( - & & (  (8 (H ( /  ( ( ,0 LP pt  ,0 0 P t  0     $ 3 7 F J Y ] e i y }                        ! ( , ; ? N R Z ^ o s z ~                         ) - 4 8 ? C J N ] a h l s w                         % ) 0 4 ; ? F J Q U \ ` g k r v }                        ! % , 0 7 ; B F UYaeuy  #*.59HLSW^bimtx &*15<@GKRV]apt !(,;?FJQU\`gkrv} "&-18<KOVZaelp    ! % , 0 7 ; B F M Q X \ c g n r y }                           # ' . 2 9 = D H O S b f m q x |                           " & - 1 @ D S W f j q u                           % ) 0 4 C G N R Y ] d h o s                           ! % - 1 A E L P W [ b f m q x |                       %)04;?FJQU\`gkrv} "&-18<KOVZaelpw{ ")-<@GKRVeipt{ !(,37>BIM\`gkrv}  '+26=APT[_fjqu %)04;?FJQU\`gkrv   ( 08@HP     $(,8<@DHLX\`dptx|  $(,8<@DPTX\hlptx|  $048<H L P T X \ ` d hlptx|/466 1331265335 1002 1002 100644 6540 ` ELFTP4(!tH% RU$ > $ >  $ > : ; I : ;  : ; I8 I !I/  : ;  : ; I8  : ;  : ; I : ; I I.? : ; ' I@: ; I4: ; I4: ; I &I4: ; I? < intrS  ~3r>!L/$#%#  a0#0#L#k La0#0#L#*0# [  |L#CL#W !"0#m#0#$0#$%0# )&0# lmi'L# dce(L#) +,0#- /D00#<1D# T Y2 450#N60#'7_ijh#kh#DlL# irqm># dman># Vo># vEJxEyKfrzQ{W|]h~cte1i|TL st0#u0## D R"E));3DD}ol {##J'0(!*)4+)Rifr,RP0.0  bionic/libc/bionicbionic/libc/kernel/common/linuxbionic/libc/kernel/common/linux/hdlcbionic/libc/includebionic/libc/include/netif_nametoindex.csocket.hioctl.hif.hunistd.hif.h(;MLGMyxLpx#^pZ  npj d ~z l0 p0 0 p p % dp  lp  |p0 80 o# 3 |  ,X   % 4=ELRbionic/libc/bionic/if_nametoindex.cif_nametoindex_gp_dispstrncpysocketioctlclose !%3:AHOV]dkry"0>M`n}(6Uhv$/p|&1<GS_m}        `          ! % 4 8 ? C R V ] a h l s w ~       /484 1331265335 1002 1002 100644 6916 ` ELF,P4(!|H% RU$ > $ >  $ >  I: ; I : ;  : ; I8 I !I/  : ;  : ; I8  : ;  : ; I : ; I.? : ; ' I@: ; I4: ; I4: ; I4: ; I 4: ; I4: ; I? <   intcDJ ow>!L $# %#   R0# 0# L#f R R0# 0# L# *0# `  L# L#] ! "0# r#0# $0# $%0# )&0# lmi'L# dce(L#) + ,0#- /J 00# 1J# Z T2% 4 50# S60#7e%i jh# kh# DlL# irqm># dman># [o># vKxKyQfrzW{]|cm~ite1oZR s t0# Nu0# #{JX+E));3JJ}u]  # #(08*0!*4,)-)hifr.XPret/0.0 bionic/libc/bionicbionic/libc/kernel/common/linuxbionic/libc/kernel/common/linux/hdlcbionic/libc/includebionic/libc/include/netif_indextoname.csocket.hioctl.hif.hunistd.hif.h* $HyJPpJztv v<'!'D@<8(! $,04$$ !0@!@'! @4 !0 @!( ! @ $!@ ! D! @<8H'D!! @<8H' C$b! !$D | 0PHP | 0PHP0 PT TUTbb0b`h`hR`R`0`aaa0a!if_indextoname00ctl_sockif_settingsloopbackifru_hwaddrslot_mapifru_slavesa_family_tshort intfr_proto_pvc_infosync_serial_settingsifrn_nameifru_settingsclock_typeindexifs_ifsumem_startfr_pvc_infofloatfr_protot391long long intraw_hdlc_protocisco_protolong intmasterparityraw_hdlcbionic/libc/bionic/if_indextoname.cunsigned charclock_rateifreqsigned charlong long unsigned intciscotypeunsigned intifru_flagssa_data__page_sizefr_proto_pvc/u/raghu/ics_feb29if_indextonamecharifnamefr_pvcifru_newnameshort unsigned intn391n392n393__page_shiftifru_mapbase_addrsizetimeoutportte1_settingssynct392long unsigned intifru_dstaddrifru_ivaluedoubleintervalifru_mtuifru_dataifru_broadaddrifru_addrsockaddrencodingsa_familymem_endifr_ifrnGNU C 4.4.3dlciifr_ifruifmapifru_netmaskifindexGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.if_indextoname.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 t>xLpx8^pZ | npj d ~0z lH p 0 @ 0 pp  pV % p{  p  p0 @0 o  T  `   %0 4=DJRXbionic/libc/bionic/if_indextoname.cif_indextoname_gp_dispsocketioctlstrncpyclose__errno !%3:AHOV]dkry(6DSft .<[n| *5v !,7BMYes        $ h     ,        ! % 4 8 ? C J N U Y h l s w ~                   ioctl.o/ 1331265335 1002 1002 100644 3440 ` ELFlP4(!(% RU: ; I .? : ; ' I@: ; I: ; I4: ; I 4: ; I $ >   eR=(4#5f)L <fd  3ap": arg# int  bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includeioctl.cstdarg.h |GE <'!'$4'40 $(' | <P(D | <P(D<( 0T 0UEioctl<<requestbionic/libc/bionic/ioctl.c__builtin_va_listva_list__gnuc_va_listioctl/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.ioctl.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 H >xLpx^pZ P  npj  ~<z  p( ( p0F  @pv H p  P p ` p0q03oEU    3   < "+bionic/libc/bionic/ioctl.cioctl_gp_disp__ioctl !%*6;GR V Z l q{           $ 3 7    ldexp.o/ 1331265335 1002 1002 100644 7224 ` ELF`P4("0% RU$ > $ > : ; I$ >  : ;  : ; I8  : ;  : ; I .: ; ' I  : ; I 4: ; I 4: ; I .? : ; ' I@ : ; I4: ; I U4: ; I1X Y 1 4141 41 1RUX Y  U4: ; I 4: ; I &IP:intMTy3)40=1g74S(5^y*lsw+#msw,#' ( -. Wt xW yW hxY hyY UZ f[#\xxana)kchxc lxc-dn ttZ't0:+Ix|EZVW|g 0u'X0:g04I48ZVW#q7#xh_'QPC R<2Su<7~bTYn( bionic/libc/bionicbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/include/sysbionic/libm/includeldexp.c_types.hstdint.htypes.hmath.hIKK@GMMKkKKLJgJJgJJrszgKKKII<'!hD` F@`DB&@!<5$` <"հxLpx^pTZ 8 np[,j  ~xz   p    @   p`O @ p   p   p  @ p0 Y 0 o. > "! p?   !&+0x 6bionic/libc/bionic/ldexp.c$LC0$LC2$LC1$LC3ldexp_gp_disp !%3:AHOT_lszJ[hv            , 0 F J S _ cx         ,@ 8 @t ,  | 0 8<DL \       $ ( 6 : H L Z ^ l p ~                      $ ( / 3 : > E I P T [ _ n r ~                   # 7 ;         $ 0 4 8 < @ D H L X \ ` d h l p t                 /502 1331265336 1002 1002 100644 8292 ` ELF`P4('$?(P% RU$ > : ; I$ >  $ >  I5I  : ;  : ; I8 : ;I '  I : ; : ;I8  : ;  : ; I8 .? : ; ' @: ; I4: ; I4: ; I &I4: ; I I!I/ 4: ; I?  int1;u<' 3)G4;Nr4^e5i;8")H) ? \@#cA Dk HE# F# G0# bH0# I# J#K    T#v## 4<$z %z# &# 'k# (# *)#$ *)#( +#, ,)#0 m-#4tls.#8z4/__ a)>b{chrQ0 7do79):";=kHn>?B;RC;D;?- .1;G2;, bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/syslibc_init_common.cstddef.h_types.hstdint.hposix_types.htypes.hpthread.hpthread_internal.hqtJJGMy 7(QyJIKu00wGMGMyMGPGM'$ $b$ ('!!B$F&!$92& 1&$ ('<'!'LHD@<I%$ ! !'! ` !@$<$&4!8b!(! `< 0 0!(@!0` $&%& $ @ ` LHD@<P'c% LHD@<P' | D(L dPPT | D(L 4dPPT(TTP`liid HTH$`,\`8HX@b,Tbq__libc_fini__libc_init_common__prognameenviron__page_size __page_shift$dd__prognameenvironsched_priorityenvpshort intsize_t__kernel_pid_t__uint32_tstacksizevalueguard_sizecleanup_stackminus1floatfunclong long intfini_arrayinternlong intsched_policy__cleanup_argthread_attrtls_area__cleanup_routineunsigned charstack_baseargcbionic/libc/bionic/libc_init_common.csigned charflagslong long unsigned intuint32_tthreadunsigned int__pthread_cleanup_func_tstacktopargvreturn_valuekernel_id__page_size/u/raghu/ics_feb29charstackbottomint32_t__pthread_cleanup_tshort unsigned intjoin_countjoin_condpthread_internal_t__page_shift__cleanup_prevpthread_cond_tlong unsigned intdoublepid_tuintptr_tarray__libc_init_commonattrcount__int32_tstack_sizeprefelfdataGNU C 4.4.3pthread_attr_t__libc_fininextGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__libc_fini.rodata.str1.4.rel.text.__libc_init_common.data.__page_size.data.__page_shift.bss.tls_area.3070.bss.thread.3069.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 T%>Lp^^pZ d% np0j L% zD2 d \%T X \ \ <p\ T  % T $%$p   4%3p u/ $ %Gpc (C , %Zp V D %hp0 s0|ox& H    '<3!A"#F Rdenwbionic/libc/bionic/libc_init_common.cthread.3069tls_area.3070$LC0__libc_fini__libc_init_common_gp_disp__get_sppthread_attr_initpthread_attr_setstackgettid_init_thread__init_tls__errno__prognameenviron__system_properties_init__page_size__page_shift  !%1>ELSZ_jw~%3AO]lw &4BP^     # '0:?JTYchv()+ ,    , !P "x # $ %  &  ' ( ) *0 ), 48 * 48  8      $ + / > B Q U \ ` o s {                    logd_write.o/ 1331265336 1002 1002 100644 13604 ` ELFP4(0-?@00(H0% RU$ > : ; I$ >   $ >  I &I  : ;  : ; I8 5I  : ;  : ;  : ; II!I/  : ; ( ' II : ; I8 .: ; ' I@ : ; I: ; I 4: ; I4: ; I.? : ; ' I@: ; I4: ; I 4: ; I !!I/".: ; ' I@# U$ %4: ; I &&I'4: ; I (4: ; I? < g/0int8;zW<.cPW(;IW;P 0( )  y* # )m+ JB # ^# r r   ?  s H#}f !?p?(0!D G>D)Y(B I J3#fdK)# L#MY\[)f[(vec[BUia)resb0)N)<tag\msgvecNXf(^)ptag fmt) apŽbufw!)<?)]tag{fmt apbufw)p)tagfmt apbufw" v)d/ fv(PvecvB#fdy)$_rc})"Hp)#[fp(CvecpBV#_rcr)t% .w&?% /w'R'T( ;(O ; bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/includebionic/libc/privatebionic/libc/include/netinetlogd_write.cstddef.hposix_types.htypes.htypes.hstdarg.hpthread.huio.hin6.hlogd.hin.hunistd.h FN$=KLKLHIM>HLrL=stGMIKEwv $K}K=$=<Ko4$JvzP( x8KJJ$=$ !!CHTC_RIL/dev/log/main/dev/log/radio<'!'<840!@,!$ ! $$ b@' $!   K$$!  (HQ%#8I!0B$ٌ! @' ,<840@'$&<'!',($<''<!!8@! $ $!(  !0 $<'!',($ <''<!!!8@!  $! @!(  !0,($ 0'<'!'$ '!!!  $! @!(  !0$ ('<'!'D@<840,($ $b,!@!D$@<840,($ H' &&#!$$D $!@ Q D$#!&" #9! !(D@<840,($  H'@$<'!',($ 1# R$!D!$$D!(  $!@P E,!($ 0'  |  P@PpPL PP pPP0dPHh  $P0X |  $P@PDpPL dPP pPP0dPHh  $P0XT 4T4 8U8`U` 4V4aaLbbp <T @U@pa HV DTDpb HUHta PVp 8T8`b 8U8da @V @Wd PTP|`|TL`Td` PUPldlU<dTddSRSRST\R\dS0 <T PUPaPtdt|R|d__libc_android_log_write^__libc_android_log_assert__libc_android_log_print?__libc_android_log_vprintLppd$Ld8DHppdlog_channels__write_to_log_initLOG_ID_RADIOshort intsize_tin6_addr__write_to_log_kerneliov_lenlog_idpthread_mutex_tva_listloggerlog_channel_tin6addr_loopbackANDROID_LOG_WARNcond__u32__builtin_va_listfloatlong long intu6_addr32LOG_ID_NONElong intlogger_function_tANDROID_LOG_DEBUGLOG_ID_MAINunsigned chariovec__be32signed charlong long unsigned intunsigned intu6_addr8ANDROID_LOG_DEFAULTlog_id_t__page_size__libc_android_log_assert/u/raghu/ics_feb29__libc_android_log_write__libc_android_log_printcharANDROID_LOG_FATALbionic/libc/bionic/logd_write.c__page_shift__write_to_log_nullANDROID_LOG_ERRORshort unsigned int__u16__u8long unsigned intin6addr_anyiov_baseANDROID_LOG_VERBOSELOG_ID_MAX__libc_android_log_vprintlog_init_locku6_addr16pathANDROID_LOG_SILENT__gnuc_va_listANDROID_LOG_INFOdouble__kernel_size_tGNU C 4.4.3in6_uvalueANDROID_LOG_UNKNOWNprio__be16GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__write_to_log_null.rodata.str1.4.rel.text.__libc_android_log_write.rel.text.__libc_android_log_assert.rel.text.__libc_android_log_print.rel.text.__libc_android_log_vprint.rel.text.__write_to_log_init.rel.text.__write_to_log_kernel.rel.data.rel.local.log_channels.bss.log_init_lock.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 )8.>8Lp8^p3Z ). np j -8. z 2, ,X  .X.H p l.(.  . .8p  . .5d1 .x.S O L/0.s$o |/(.p /p. 08. p L0."p ,4.$p P 44@.&pYp t4.( p00hoz.8%0/% h(L   ! 5$BdVd "$&(*z+,pp#(0Ebionic/libc/bionic/logd_write.c__write_to_log_nulllog_channels__write_to_log_initlog_init_lock__write_to_log_kernel$LC1$LC0__libc_android_log_write_gp_dispstrcmpstrlen__libc_android_log_assertvsnprintfexit__libc_android_log_print__libc_android_log_vprintpthread_mutex_lockopen__errnopthread_mutex_unlockwritev %@)`,- !%1>ELSZahov}&4Q\g")4b}    ,?I`kos|ALPT]gv (2AFU\x  :Um&&8 '4 <` ( (   && *P %d +&&, *X %&&( *H %&& .  / 0   1 X `&&, <P 2p 0     $( DHdh ( Hh    ' + < @ G K \ ` g k r v }             )-<@HL]ahl{   /3;?PT[_fjqu| #'/3CGVZaetx  (08@  $0 4 8 < @DHLPTX\`dmd5.o/ 1331265336 1002 1002 100644 12292 ` ELF!P4($!xp% RU$ > $ > : ; I $ >  : ;  : ; I8 : ; I8 I !I/ .: ; ' I  : ; I.? : ; ' @ : ; I  I.: ; ' : ; I4: ; I.? : ; ' @: ; I4: ; I4: ; I U1RUX Y 141&&I4: ; I 4: ; I !4: ;I:/Bsint4W+a W 5Lymd5X(sz)# *# + # W    0 ? >? x> n>WA4<cm4cTL mLc&LAANBBNCCNDDNmc!vϘJlenϊhpџPҊӊlڊip(vPHq4x5,0W'resmc;'WW  !iE!r7 07 G0zZ bionic/libc/bionicbionic/libc/arch-mips/include/machine/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includebionic/libc/include/sysmd5.chash.h_types.hstddef.hstdint.htypes.hmd5.h4GKKKGKKKGKKFP<HOzJPJyJJNKNKKKLKKKpJKJM~JNKKKLKKKLKKKJLz~0LIHQ8IK8IK8IK8HL8IK<<8HL8IK8IK<<HL8IK8IK8IK8FN84IK<8HL8IK8IK<<HL8IK8IK8IK8HL8IK<8IK8FN0IK0IK44HL0IK40IK0HL40IK40HL0IK0IK0IK484IK4IK4HL4IK4IK4IK4HL4IK84IK4HL88IK4JJ0IKKKGKKK)J$GPGHLEP=NEKFNPGNzJKMMHzJNMzJKKLMpJEg <2<<<#I5vT54b4 <'!'tplhd`\XTP! !+S!`$0@ &$&˜!&(&,&8&< &@ &D &H &L&P &T& ?s2&$(0&4&,048<@DH@$#+Q _! !(!0  !q!u#Q@#tplhd`\XTPx'  j<ʎx5'`$(!$!*%!HqY B % ! <y'0V5$P!8$!%(B!%K]%i! $<'0p5$($8!P!B%!Hq@\ c %0!`  <' J4$?$!8 !X%H3!@i%(Y!$ |<'X*6!Hj$@c$L!?%8!'QB^% j!X( 9G<' *7!8($,$Pb!%Hj!@%9!kʏ0<'F4$@$+!HS!,%8!Pg@ K %0?!0F <'85!($P$!`b%H_!@:%(!(, i<'`ؘJ4!H$@$Ȧ!+%8!gQB% !0D <'@i5!8)$$!`%Pb!XK  %)!4'<'[5!P$`E$X?!F%H!@)@%0S!8\ <'K5$@?$Y!H!`%%8!P] %(+!(< 'k<'`"h6!P$X$!_%Hq!@iaB>% ! @K<'q7!Hq$@b$`!P9%8 !G[%+!dDhy<'C)7!` $8e$P$!X%!@Lc%0!0H I<'@!G4!G$$X!`%H+!=%(! I?MD5_InitMD5_UpdateMD5_Final,<pt\$|pt\|pt\|48<l<bionic/libc/bionic/md5.cdstartfloatdatalong long unsigned intunsigned charold_szMD5_Finallong unsigned intshort unsigned intsize_tcounterdouble__uint32_tMD5_Updateunsigned intu_int32_tsavecshiftlong long intGNU C 4.4.3charoffsetshort intcalcuint32_tlong int/u/raghu/ics_feb29signed charzerosMD5_InitGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.MD5_Init.rel.text.MD5_Update.rel.text.MD5_Final.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X`5 )">Lp^pb>Z )" np~j +" z <\  +" + "pt ,0"xt D,"p3 \,p"p< ."p[0 . " p ."p0;J$0 -o  ='# T)O    < #.7>Hbionic/libc/bionic/md5.cMD5_InitMD5_Update_gp_dispmemcpyMD5_Finalmemset @ !%,3:AMZahov}AH L j   "'4= AR[dmv      g  8  ,    $ ( X \  ( \     ! % , 0 7 ; J N U Y h l s w ~                       # * . 5 9 H L S W ^ b q u |                       $            ( , 0 4 8 < @ D P T X \ ` d h l x |         memmove_words.o/1331265336 1002 1002 100644 5352 ` ELFd P4( % RU$ > : ; I$ >  $ >  I.? : ; ' @  : ; I : ; I 4: ; I 4: ; I &&Is:int;M(d$ $ src$ n$0< d(p s) *0\   bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includememmove_words.cstddef.h$   MKIO<=IKLGDV<Lj5KLIwJ JuJJHHJJ 4!@2!H+9@#8%Xj1-@&H(1,!P$!@! $!p͕!`c$iB$X%@x!H!@0J$@! @! !$e$Ec$B$Y% !H$!@&J$0B0$!0+`%X! !(%b0@@&Xj1$ 8B@#0!!8!c$B$i$I@`#@ !(! @!8!!c$B$m$M#x0!(!  |   |  T TUUVVVV4X|XRX X DTDpRpTRT0YxYSYYDUDlSlUSU@LZLSZTZXZVZ,4W4DXDtWtXWX!_memmove_wordslong long intsize_tdestunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned int_memmove_wordsGNU C 4.4.3charlong intcopyCountdoubleshort unsigned intsigned charfloatshort intunsigned intbionic/libc/bionic/memmove_words.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text._memmove_words.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p)Z  npCj  zp    p  p% p  p p0*0'  o9 I d` 3   $ bionic/libc/bionic/memmove_words.c_memmove_words !%1>ELSZahov}                 " ) - < @ G K R V ] a p t {                             ! ( , 3 7 > B I M \ ` g k r v }                           pututline.o/ 1331265336 1002 1002 100644 6700 ` ELFPP4("% RU$ > $ > : ; I $ >  I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' @: ; I4: ; I4: ; I  : ; R@intl 3)^$ 4S% lM")3l4lCYHcdNW1 ~X1# Y)#>TwY _px1# _ry)# _wz)# {E# |E# _bf}# ;~)# # i# #$ #( \#, #0 _up1#8 _ur)#< x#@ S#C _lb#D )#L #P )i Y ) )o  ) )  ) >>7E. p# #>N5w D6E# 7E#c`< =E# ># _?.# @# A.# hB># 3DN#, wFl#0 4G#4 I.#< :J>#L.>N;!xc!!f#Ju$wi%lret>wV bionic/libc/bionicbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxpututline.c_types.hstdint.hposix_types.htypes.hstdio.htime.hutmp.h!4Oy> x( /var/run/utmpw+<'!h'|x!& &+@!@&' '! @`$$ !8$! `!( %C$ @ ! @E$!  !0@! `$$ !8 ! |x' ! & &@!@! `$$ !8 | ,xP` | ,xP`x HTHd,xdT\`\hRh$`$,R,X`XpRpx`RRNpututlinexxe_exitut_user__kernel_suseconds_tlong long unsigned int_lbfsizee_terminationGNU C 4.4.3long long intsigned char_ubuf_baseut_addr_v6_cookielong int__kernel_time_t_flags_blksizedouble_offsetoff_tsuseconds_t_readfpos_tunsigned int_closelong unsigned int_fileut_idshort unsigned intut_exitpututlinetimeval__kernel_pid_t_writeutmput_hosttv_secut_sessionbionic/libc/bionic/pututline.ctime_tfloatint32_tunsigned charexit_statusshort int__sbuf__sFILEFILEut_typetv_usec_seekut_pidchar_size_ext__int32_t__kernel_off_tut_tvunsed/u/raghu/ics_feb29_nbufpid_tut_lineGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.pututline.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^psZ $P np)Zj t z2x | p @  P @  p  $ pM   pm   p   p0 g0 o & (! k     % *x4=CIQW]dbionic/libc/bionic/pututline.c$LC1$LC0pututline_gp_dispfopenfreadstrncmpftellfseekfwritefclose !%3:AHOTahov} #8ky!=K O[ixPW [ _ hr    ( < DLh      , 4 <@ 8 HX        ! % , 0 7 ; J N U Y ` d k o v z            realpath.o/ 1331265336 1002 1002 100644 8360 ` ELFP4("0% RU$ > : ; I$ > $ >  I : ;  : ; I8 I !I/ .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I4: ; I &I!I/4: ; I? < int;0w h-.s#/#\1e#3;#64;#c6s# 7s#$}9s#(:#,T<^#8->s#@w?s#DcAs#HUBs#LDs#PGEs#TlGs#X?Hs#\Je#` s  ` ." K.a sb0p1q1s1J20sj203;4)4)(F5ȟ5ȿ5_ ;;% bionic/libc/bionicbionic/libc/include/sysbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includerealpath.cstat.hunistd.hstddef.hstdlib.h.<xJRLx$zJK4JEJ==KHLKu=KLvIK>I\J=L4KqJA0u{==IK>I JKL=Y<'JYJ'JJ~KKKs~tuIK...<'!HϽ'0000000000! !D#/$b0!  $@ ! '!( ! $ !@!@&.j.iK  '0''0!  /$V@!@!@#I.W !0@!  !(!#P!*`h@&!  &&!K/$c&.<!hC!  %@!  &<@. `!!  /$U$#@ .@&!/$000!0000000000'!#I.  !0N$T0!000000000'! !( $!@B,@!  !(T@0400 ,b0!  $C@!@!Hh /$:. @!X`!  /$R$#V@`!g L/$1&-.!ph Ch 0!( $O,0!  $0!@'A 0.â#`%&'!  $!@&$${! $Q0` 0Wn0! $ $e! Z$!^_0 | 0Pah   | 0Pah   LTLa@aaha LUL,fLffc R c8cL`R`cchccbe<bLTb`bXbd4dLtda@aLaaaa0@aaee0eLeehee R @a`a a TRT|aa0Rrealpathsymlinkscharsize_tstat/u/raghu/ics_feb29st_atimest_nlink__pad2leftresolvedst_sizest_inost_mtimest_blksizefloatst_rdevleft_lenunsigned charrealpathsymlinkslenst_blockslong unsigned intst_modeshort unsigned intdouble__page_sizest_ctimeunsigned intbionic/libc/bionic/realpath.clong long unsigned intst_ctime_nsecst_mtime_nsecst_uidresolved_lenst_atime_nseclong long intGNU C 4.4.3serrno__page_shiftshort intst_devst_gid__pad0__pad1long intpathnext_tokensigned charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.realpath.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pxZ  np\j  z2t|  p D ( d D 8 p  @@ p0  pO   po  p00}o'`! x    $ )2;CJQY`gov~bionic/libc/bionic/realpath.c$LC0$LC1realpath_gp_disp__errnogetcwdstrlenstrlcpystrchrmemcpymemmovestrcmpstrrchrstrlcatlstatreadlink !%1>ELSZahov}#1?M[iw       , 1; @J O_oy ~2 < d |       8  !  !  " \ `  # $ %@ " #  0 L l h t        " & - 1 8 < C G N R a e l p w {                           ! % , 0 7 ; J N U Y ` d s w ~                            ( , 3 7 > B I M T X _ c j n u y    /522 1331265336 1002 1002 100644 4444 ` ELF$P4(!|(% RU$ > : ; I$ > $ >  : ;  : ; I8 I !I/ .? : ; ' I@ : ; I : ; I 4: ; I I7kint;J0")Ha)b#s ac g)t4 pid B03 set4\ ret!)tT bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/includesched_getaffinity.cstddef.hposix_types.htypes.hsched.hIKM7<'!'$ ! !@+P`!$ ('#0! " !(! | tP(L | tP(Lt( 0T 0U0T`\t` 0V0Pa\ta8LR\lR$;sched_getaffinityttlong long intpid_tsize_tunsigned char__bitslong unsigned intsetsizelong long unsigned intcpu_set_tbionic/libc/bionic/sched_getaffinity.c/u/raghu/ics_feb29GNU C 4.4.3charlong int__kernel_pid_tdoubleshort unsigned intsigned charfloatshort intunsigned intsched_getaffinityGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sched_getaffinity.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 <>xLpx^p7;Z D nprxj D ~tz L  p`0 l0 |p pc( 4p  <p Lp0#0o!L   ^   (t :CWbionic/libc/bionic/sched_getaffinity.csched_getaffinity_gp_disp__sched_getaffinitymemset !%1>ELSZahov}      / a  @         $ 3 7 > B I M \ ` g k r v        sched_getcpu.o/ 1331265336 1002 1002 100644 3456 ` ELFDP4(!t(% RU$ > $ > $ > .? : ; ' I@4: ; I6jint(}XO)Lcpu#0 sW bionic/libc/bionicbionic/libc/includesched_getcpu.csched.h!vKM<'!'$'!( !0@$('!(' | LP(D | LP(DL(8@psched_getcpuLLlong long intunsigned intsched_getcpuunsigned charbionic/libc/bionic/sched_getcpu.clong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3charlong intdoubleshort unsigned intsigned charfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.sched_getcpu.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 0 >xLpx[^pZ 8  npwj  ~Lz  pH(  p( p4 ( 0p# X p  ` p p p00 o%l    B   #L 09bionic/libc/bionic/sched_getcpu.csched_getcpu_gp_disp__getcpu !%3:AHOV]dkry    d          $    /543 1331265336 1002 1002 100644 4260 ` ELFPP4(# % RU$ > : ; I$ > $ >  : ;  : ; I8 I !I/ .? : ; ' @  : ; I  I .? : ; ' I@ : ; I]int; %pKa3b#s c  set%  :  0" bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includesched_cpualloc.cstddef.hsched.h%  <'! <'!$B!   |   |   $ T T7__sched_cpufree__sched_cpualloc$  long long intsize_t__sched_cpufreeunsigned char__bits__sched_cpualloclong unsigned int/u/raghu/ics_feb29long long unsigned intcpu_set_tGNU C 4.4.3charcountlong intbionic/libc/bionic/sched_cpualloc.cdoubleshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__sched_cpufree.rel.text.__sched_cpualloc.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 !>Lp^p]Z ! npx&j ! ~z !   !p0  !0 4!p8& D !p^; d!p( l!p  !p0!0*o: " x[   % 5>C Tbionic/libc/bionic/sched_cpualloc.c__sched_cpufree_gp_dispfree__sched_cpuallocmalloc  !%1>ELSZahov}            $ (  (           /561 1331265336 1002 1002 100644 4356 ` ELFP4(!40% RU$ > : ; I$ > $ >  : ;  : ; I8 I !I/ .? : ; ' I@ : ; I : ; I 4: ; I4: ; I I/1int; oUa#b#s c ), g0 set,> nn!)\*!)o")' bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includesched_cpucount.cstddef.hsched.h(MINsz<'!',($ !!!D 1&!bR&,!`($ 0'! |  P0T |  P0T0 DT\T LU\U<pa,t`|`8hc|c#3__sched_cpucountlong long intsize_tunsigned char__bitsnn_maxbionic/libc/bionic/sched_cpucount.clong unsigned intsetsizelong long unsigned intcpu_set_t/u/raghu/ics_feb29GNU C 4.4.3charcountlong intdoubleshort unsigned intsigned charfloat__sched_cpucountshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__sched_cpucount.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pF3Z  npy+j  ~z  p(4 \4 $p ,p;' pb  p p00o    M   %3 Dbionic/libc/bionic/sched_cpucount.c__popcountsi2__sched_cpucount_gp_disp !%1>ELSZahov}       '  <         $ + / > B I M \ ` o s z ~        semaphore.o/ 1331265336 1002 1002 100644 15600 ` ELF!P4(30      (?8P?8% RU : ;  : ; I8 5I$ > : ; I$ > $ >  : ;   I &I .: ; ' I  : ; I4: ; I4: ; I.? : ; ' I@: ;I: ;I4: ;I: ; I: ; I1X Y1 41414: ;I4: ;I4: ;I1X Y U!4: ;I "1RUX Y#&I$.? : ; ' I@%4: ; Ir#@A$@#E"%)intC|[~ (3<d b5T#Z#  WA kAEoldEnewEretW @ 2W kAEoldEnewEretW GW kAEoldEnewEretW.-Wd'sem' O->valWQ L W2W<d`w+W`sem'/'@w W&,Wpsemo';AqW.W|YMsemZ'yZW;ZE1Wsemi',hp ,h'E*5Q0WTcAsemP'REoldSWG<[X<cny=i6Wh[;sem '| ;ret WEH HA*5 !ts+Hret,Wj"0> H A#b$3Wsem'#%EW"<` xj bionic/libc/bionicbionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxsemaphore.csemaphore.hposix_types.htypes.htime.hwOENvuH uHE xFNH wKKzuKLHKw=$~OEOQyJQzOqGHLu=0L JwJ JF LpMN $ EFNoJwD<NOEOQyJQz2JR0H JJMJhJKIKIKHKL~QyJQzJP}wEOFNf(KIK= }]=0JJPJQyJQzPEuKr$=<'!'  !C0( 0 ' $C$<'!' Y$C '$<'!'  Y$D '$ $C '$<'!'( ,Y$C '!<'!'@! ' $D$ $C$<'!'@<+@@0!4 '! ' $D$<'!'$ #!$12$E$!0% Q @%( @!$ (' $ $F $(' $C$<'!'40,($ 7!?<R26$$(% %( !0 @$$ C$$% %( !0 @#40,($ 8' 4O$C0$,($ 8'4$0,($ 8'Lp^p|Z -P1 np; j 82P1 ~( dz 21  < 21 ` 21( @ 21h p 21 | 31T 3(1$T  @3(1#xh h3`1;7 3(1NpLJ 31!_L[ 4P1#mphi 4@1%|p!x ;1'ph (;X1)p/ ;p1+p00o )2 ,   !#%')+-./ d -6><I`S@\ph|q}Thbionic/libc/bionic/semaphore.csem_getvalue_gp_disp__errnosem_unlinksem_closesem_opensem_destroysem_initsem_trywait__atomic_cmpxchgsem_post__futex_wake_exsem_timedwaitclock_gettime__futex_wait_exsem_wait !@"`#$%&(* - !%2HMahov} HYd  "5@ D HQ[bm q u    */9>HOZ^bv #,5CNRVjoz%3BLW[_ns}   5 L h      ` < '  ' ) X '  +H X ' , +  L T ' ,  ,0 DH \` tx $( 0 H ` x (     $ + / > B Q U d h p t                     ' + ; ? F J Y]eiy}  '+26EIPTcgos#*.=AHL[_gk| #'.2AELPW[jnuy#'.29=DHW[jnuy   ( 0 8@HPX  $048<HLPT`dhlx|          sha1.o/ 1331265336 1002 1002 100644 19624 ` ELF4P4('$@?88% RU$ > $ > : ; I$ >  : ;  : ; I8 I !I/  : ;  : ; I .? : ; ' @  : ; I  I.? : ; ' @: ; I4: ; I4: ; I4: ; I &I: ; IITintg}440fKZ(5S-t>>v0y\# ##  ! ?= @8G c9 l:GW ;, H ĈT!@ |T}%!a4bcdle`0PW~+Ws\R׈r8%len٨iۨjۨ FD?D_}i`  bionic/libc/bionicbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/include/syssha1.c_types.hstdint.htypes.hsha1.hKKKKFKKKKFKKKKKK (DuJKH Js8 JI0(KIIKIIKKIKII=KKIIKKIKI=IKIKIIKIK(IuIKIKsKsKIKIKIIKKKKIIIuI,I;KIKIKIIKK,IuII$IIKIxJPIKKIHLHGKKO$FKKKO0zJQyQyJQ=Lx=KIN,K$Ju;>KJ Eg < <<2<<#5I55vT4b4 p'|xtpl'@$  $HGF CB$ b<<4c4 &%@%$8$p$c%hfBZ!hn&@ž@yb%o!%%X$$c!xB&@pO$%!%%.!ž@ r Z V &%xx!@%. %Pj$`p$C$o!%h!X%5&xž@>rR!`o&X%xx%%8U$!$wpG$!!0%&X~> ~ $r R %%p!%PG!X¦$$8C@%P&0%(H$0xg%`!s!H&6:Hv@y!H3&%P!H4%xp%$w,_%Xn!*$8&!$x%x®&8lj!V@v%0%$0%p!ohO!t%H-$!@&8$p%p¶!n&8+@Q2%P%4$!@%0!@ %w$!P$h&8%h6¾@a!8G&Pi%!8%`$H%0G8!8%@$&P!0b$`%`&!0@V%$^!0!0%&!H"%Xv<$¦!7T\PN?%8$XeT%\%X~&@%^$!P!P^!b&%H77%0!~ž P@P$$H%@ %H6%T`P`%&T\P%$j W %PT!\!!@&gD$$!žP%TPF`\@%`P%\T&@F`%$@!%P`$X!!8$&&(W@A!®%c%&L&(&(!8$v!8%@&(!0&@j/%!0@)&@ž&%e&@!0$/8!0%(&&8@!BG%h!PV&8¶&@A&8%@!PS$F0!PH%!&01@@&W%@!& &0@9 %8&0$*!H!G!@8&%7 P %8%*&!P@1¾&%Hn<4&!G&P6!^&@&R!(W‡%%PR@–!(&)%P&(&Q!(!(&!@%Y!!2H%¾@%&&&L&&!&&!9L!@(%X%@&(#!PF%8&H&W%PP&(H!"!9&x@/%%!@)&x†%&x!!H!@%&(WH&&p/%(!&p@y%x/&p!!H!@xw%x&ȪH&hm&8%!&h@q%p&h!PF!/!.H@p o %p&H&`,&W%PV!¶&`@i%h&`!(!! H@h g %h&WH&/&X%(&X~!@a%`,!&o&XH&Xx%!H!@`%`!X @%8&&6&HiH&H2%6&H.H!Xl!Xx!PF@ O % !PV@I ¶ %!(&H7&H&&H+/ X %(&H!PX!PV@§%!Hi¦ @Y %X&&&cH&q P %&lH!H6!H+!@X%Xc!¾ @Q %P&&&H& H %&H!k!j!&@P¯%PU&®!)@I%H&o&&v&!*H!)@HŸ%H3H&@!(%!(@&F%@!&H&y%&kH!(!(&8G@@Ÿ%@!#&@>%!8h&&*&eH!@8%8H&^!(%e!@)&%(!&t&H%&)H!!@(&2%(&X!ȣ®@%&H!!%H!#@—%r&H&&%!U&V®@!f%!&H&%y&GH!U@—%R!>@!B%&tHXLH&!>&+L&%%Y!0X@%L&5¾@%L!0!0$HP%&7%0HP& <ܼ16&$!7%!@‡%0!@%!$H%P&xH%&xP&x$!%@!q%!t@y¦&%L&p&p!p$xPH%H%uP$!%x@w%H@q¾!Q%&h H!O&h%x&h!$x$p!W%%x!0§ @p &`%p@i!&`%xU¾&`%!0$hU$x!0%x¿ @h %h%¾&x@a&C!%H!%x& $x$`!0!%%`!q—@x&V%x@1!l&%`&%!O7$$`%0%`L&+@_L!x!%K®@Y!` &%f%& $$Xf!`!`%& %X@!%x¦ @Q %!X&&%$$P!Xs ` !X~%&%P !@`·%`&!@I %tV $%PI$Ht!& %HX &H!P%!@X%Xx@1 !H&%@V%&$!H+$@V7 P !H>%0&g%@@P!¿%PW® @9 %&!@&& %$$8&!@  H !@%%8@H!%H8&E¦@)!8!8&%!8%L&$$(@%%(!@@&%@!%¾&o@)!&j$%($8!(%%!0&"@8%8!@&!0%%$(%& L$t!%b@0!%0&!.@%!PL$(PTL%!(HP&sT&h$&YP%%@(!%(!@P%!L%U$UPL&,!^P&'$%%!@%b!@%8!CL$PL%!XP$%>&%L& H&&@¿L!%W!¶HHL@%L%!H$$LHP!%LP&%HH&&p!@%!&@vL%PL%&p!H$PHT!L$T%L!&xo%&M@w%P!4L&@i®%!h&&"&H!h@b<5H%P!.%!/@ &x® %&&-H h %-&xH!7!5&@!%! @y&hF–%xO&h!!!H@x o %x&4H&Y%!@i%h-!&&sH&e&0%&wH!O!M@hŸ%h!ž@%p!.&&`LH&`&r%2&`H!-!0&X+@ g % !Sf&b@Y%`!Xp&4&O&yH!Xl@`—%`H!%y&P !¶ @ %&PX&q&PM&!,H!2@ W %JH! X %!X¦@Q%P&&&HH&H>%&H0H!Xr!Xj!.@P O %PI!H9@ %1&H!H*!H9&ȧ!8nH&@&kH&@ X %k&@ H@G%(!@@9 ^ %Xg!&8tH&5&8 H %&2H!@!@ &0f@X%Xy!8'&0@I%H)&0!!8H!8@H7%H&&H&(@%&(EF!@1%0&(&@&(&@!)H!&@0/%0H&!nG8%@!e>&(p@%&8&8H?%8&(H!f!c!@/%e&@)!%%&L&(&I&(!!H@%"H&!/%(&ž!@%b&F!&!&&@!@—%V%r&P!@¶@&C%!&E!~&&T!8GW@%%!&P–@&Y%^&8!P!PQ!&&/@%%^&ȫ !@ %X~&&3!8!!N&*@ Ÿ&xP %J%3&!X@&!xq&H%!!@&5&h@Wg8%G% !&0~@&`!X8&Ht%!v!h@ &p>‡ %80!(F@1! %%!!p!4!h!(p!P3|xtpl '<'!'40,($ !0!!+ b!#)BG'%!(%X?d1!PD@B-@3&!#0P!(! d40,($  8'@$#! d!( !0!  !(`? &+` !!(@& ! ?&+p@&! #0P!(! d40,($  8'<'!'40,($ !!!'$$$N,!h h!X i'P@ ! B$Ed$$ ! $0 $R&! !(@ $3!(!  $ 4!$PH !@ ' !"B$Et40,($ 8' |  H,@Dd (\P8\$DP8X |  H,$@Dd (T\P8\$DP8X@U8g8|Zg X 8fx$Xfg,RX f $ f$ Z\ Z t d $ S$ <gg4n`nV@Y@Ped ] ah[flWlHXSUg|f[fXg]c n@b@ Zd h g D [D P U U c|n|VXVXdgZVDned,iTcXd8dX|hetePgP`Y`ng(YhZZa, i H U f i8 i h d ,e,bb$dT[f(U(ftgthfbaHYfLfL RXnxxVgV<dpg[ VHVf ` ZP h g T ST < et i chdeL\LhdW$g\hD`p`dh[hhc c UlelxZxc@gWhgh\W@W@<UtU g p ip , U Y g8 n dPePlcceHXd hnhi8i|fidPiW Z 0R0d\8 HTHaPa TUTdDd <V<bLb`T`4pRpTT(8TD8 HTH8a HUH<`8RDRJbSHA1InitSHA1Transform6SHA1UpdateSHA1Final4H@\DH@\Dstatebuffercountfinalcountbionic/libc/bionic/sha1.cdataSHA1_CTXSHA1Finalworkspacefloatblocklong long unsigned intunsigned charlong unsigned intSHA1Transformshort unsigned intuint32_tdouble__uint32_tunsigned intu_int32_tCHAR64LONG16contextlong long intSHA1InitGNU C 4.4.3charu_charshort intu_intdigestlong int/u/raghu/ics_feb29signed charSHA1UpdateGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.SHA1Init.text.SHA1Transform.rel.text.SHA1Update.rodata.str1.4.rodata.rel.text.SHA1Final.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 = %>Lp'^pZ @=% npj X? % zH@$$\ x?8%2%%%D ?H%p& ?@%' 8@ %p,( X@ %p0N  8L%#p318 @L(%6pk1(2 hL@%Dp01~O03Xo#333h:& <\   !"# H )@7\BKRDbionic/libc/bionic/sha1.c$LC0SHA1InitSHA1TransformSHA1Update_gp_dispmemcpySHA1Final @`  !%3:AHOTahov}"Xdk o {  8? C GPZ_ix     Y     ( | x     $( TX   ( X      ! % 4 8 ? C J N U Y ` d k o v z                               & * 1 5 < @ G K R V ] a h l s w ~                             $ + / 6 : A E L P W [ b f m q x |                             % ) 0 4 ; ? F J Q U \ ` g k r v }                              " & - 1 8 < C G N R Y ] l p w {                               ' + 2 6 = A H L S W ^ b i m t x                             ! % , 0 7 ; B F M Q X \ c g n r y }                              " ) - 4 8 ? C R V ^ b r v }                        ! % , 0 ? C K O _ c j n }           (         ssp.o/ 1331265336 1002 1002 100644 7956 ` ELF8P4((%P % RU$ > $ >  $ > : ;I' I  I &I  : ;  : ; I8 I!I/ : ; I : ;  : ; I<  : ;  : ; I8  : ; ( .: ; ' I : ; I: ; I4: ; I.? : ; ' @4: ; I 4: ; I 4: ; I1RUX Y  1! U"41#1RUX Y $!I/%.: ; ' @&4: ; I' (4: ; I? < )4: ; I?  ahzintrZ aE   sig# h+> fhi;/E/} 5' Edx/eL#aj#n#!MF`O$u[Eset[ !LE setLLEN  hUE0setU5A4saCA_D_E{F_8GE! J 8K  !0"#H[ $ "  $%*?S&fd,E_'@t&len0}(L(8L(8(9  7(:)%}\ bionic/libc/bionicbionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/asm-genericbionic/libc/privatessp.csignal.hstdint.hsignal.hsignal.hunistd.hctype.hlogd.hst JsJ~(QyJyOL$n *uvMIKIHKM/proc/self/exe/dev/urandom<'!'LHD'! $ $$$$!(!0 @'$!(  $$#C!(&%!(  $0' $('!00( , ! @ $ $$!  $<'!'$ !(!@$!  $!  !@$$ $ 'stack corruption detected: aborted | 4P LP H | 4P L4P H4 R,R 4``t```90__stack_chk_fail__stack_chk_guard$4 8<@8<@H8<@H4messagesigemptyset/u/raghu/ics_feb29siginfosa_flagscount__sighandler_tANDROID_LOG_UNKNOWN__sigaction_handlersigfillsetANDROID_LOG_FATALssize_t_tolower_tab_float__stack_chk_guard__guard_setupunsigned charANDROID_LOG_ERRORsa_masklong unsigned intsigset_tshort unsigned intANDROID_LOG_WARN__stack_chk_failANDROID_LOG_DEFAULTdoublebionic/libc/bionic/ssp.cshort int__page_sizeANDROID_LOG_SILENTunsigned intsa_handlersa_sigactionlong long unsigned intANDROID_LOG_VERBOSEsignum_ctype_long long intGNU C 4.4.3charsigdelset__signalfn_t__page_shiftsigactionANDROID_LOG_INFOANDROID_LOG_DEBUGlong intpathsigmasksigned char_toupper_tab_local_setGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.__stack_chk_fail.rel.text.__guard_setup.rel.init_array.bss.__stack_chk_guard.rodata.message.2969.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 4&>Lp^pZ DX& npP`j & z2,4 &  4H&  |&  $p L  & $ L  &pp  &*p =& D&>p= (: L&Qpe M d& _p0 j0sox' X   #' "5 : ? #$D4U^eqzbionic/libc/bionic/ssp.cmessage.2969__guard_setup$LC0$LC1$LC2__stack_chk_fail_gp_dispmemsetsigprocmaskreadlink__libc_android_log_printsigactiongetpidkill_exitstrlcpyopenread__stack_chk_guardclose   !%,3:AOV]dkry6BN\j29 = AXgsx     #5: > MTan{, D   !H "l #h p $  % & ' ( )   * $@ +D ,\ -t ,  48  8     ! % , 0 ? C K O _ c j n }           $ 0 4 8 < H L P T X \ h l p t stubs.o/ 1331265336 1002 1002 100644 34816 ` ELFKP4(XU((((((    ((?80?80 X00% RU$ > : ; I$ >  $ >  I : ;  : ; I8 : ; I8 ' I I &II!I/ 5I : ; .: ; ' I : ; I: ; I4: ; I.: ; ' 4: ; I.: ;' I : ;I: ;I4: ;I.? : ; ' I@ : ;I .? : ; ' @ .? : ; ' @ 4I4  !.? : ; ' I@": ;I#: ;I$.1@ %1&41'.: ; ' I@(4: ; I)1RUX Y * U+1X Y ,1- ..: ; ' @ /: ; I0 : ;14: ;I21X Y31RUX Y 41RUX Y54164: ;I7: ; I84: ; I9 : ; :&I;: ; I <4: ; I =!>4: ; I? < # 0int;|]o4;bK5^} w>;@;;iCe27 -3# R4# 5# 67# D N+ Wq $ Xq#  Y)#IT w _p xq# _r y)# _w z)# {P# 8 |P# _bf }H# ~)# #  # #$  #(  #,  H#0 _up q#8 _ur )#<  #@  *#C _lb H#D Y )#L  =#P )  ) ) = = ) )   ) I*I: w3f g# h# 5i# j# k# l# ] _ ^#  _7# % `)#  a# " k" K l#  m7# K n)# $ b %#  &#  '#  (#  ))#  *)#m U 0 V # aid W;#g  ;# uid ;# gid ;#  # )Q P)pvP 3wE# x# yP#( z`#0 f{`#P`p%|xpw$Etgr$sp3_ssfXgr0 $n;;2gid22gr4grid;$ߨn;pwТ0 $Ҩn;9uidpwspwâid;$Ũn;UK)(g TgUVhVhW)*wcT <"" bT Q <Q !aX@ < ! X`") < ! X "0  <0 0  !  X #net") <  !)L  #fd),#buf?"0R!Le #fd)!S 14 L4 #f: ":!H  Ln "0 $ % &' (s1)x * &+, -&.:$';Zf /0 z(id~(end0P!;d& "0 "1Vid;2` ,8,.-`&C&N3`@,,4XX,v,j*p5!:$ #gid16grr2X ,,-X&&+p,,4X,v,j*&!]q "Y 1[2``p ,,-`&&3{`,,4c,!,*5-D! rLm[#uidH1J6pwK29XR4,T,J-X&^&i+{p,,4U,!,*&-!`HJ6pwuj'()_/()/0( 7uid(7dst)/7buf)X/\)0/)_8>/)(rc0)(src3eA9=_8EB0u95\`k:3E!u)P7uidj7pwdj7bufk/\k0;k_!vt)TD/0d  7pwdd2 7bufeP /\e0c ;e_T&< Ze Dz j% <2s<t:=> >;>I;>%8 >*9 P>: bionic/libc/bionicbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/syssystem/core/include/privatestubs.cgrp.hpwd.hstddef.h_types.hstdint.hposix_types.htypes.hstdio.hnetdb.hmntent.handroid_filesystem_config.hpthread.hunistd.hctype.hIL}Ku0 u0 u0u0u0u0u$u$u$u$ $I _>jJJjJJat!B<=KpN0?}0JNIIKKKJz,P$JJ<HKKK(?}YLHKKKJ<yQHKKK0>~!J[MGLILIKFLKJz,P$JJ<$GKIKHKKK(?~hMIGLLIKFLKJG8<xRLLIKIMGKKuN)<EOELB KIKKIKK(JHLQ0t ,IvJJEKFQ]&<u, uIK( @$$Ŭ$FIX ME! implement %s() %s:%d bionic/libc/bionic/stubs.cFIX ME! implement ttyname_r() %s:%d FIX ME! implement ttyname() %s:%d FIX ME! implement getmntent() %s:%d FIX ME! implement getgrnam() %s:%d app_app_%u//system/bin/sh/data%s%c%s%c%srootsystemradiobluetoothgraphicsinputaudiocameralogcompassmountwifidhcpadbinstallmediadrmavailablenfcdrmrpcshellcachediagnet_bt_adminnet_btsdcard_rwmedia_rwvpnkeystoreusbmtpgpsinetnet_rawnet_adminnet_bw_statsnet_bw_acctmiscnobody<'!'$$$$$ $$('<'!'$$$$$ $$('<'!'$$$$$ $$!('<'!'$$$$$ $$!('<'!'$$$$$ $$!('<'!'$$$$$ $$!('<'!'$$$ $$ '<'!'$$$ $! '<'!'$$$ $! '<'!'$$$ $! '<'! <'!'$ $ $ $@!@$! ('$ p$@!@(B$$$B !(@@!@ ! @  $C$<'!$ $<'!'$ $$ !@$ b, @&  $I!$ (''  $'B$'H,$<'!'40,($ Y$ ! @!@Q$R&8U&R&#US! ` !(@$C 4! 0,($ 8'4!! 0,($ 8'$ ! 'E,!@ !$G4P&&%! ` $ G$$ <'!',($ Y$ !#@!@R$b$8D$D'.EB$B$F$$& 0,!@($ 0' !$H,,!!@($ 0'P3&F%! ` $ &$)3 03 <'!'40,($ Y$ !%@!@!@R&8U&R&(US! ` !(@HE$$ 4! 0,($ 8'4!! 0,($ 8'Y% ! 'I, !@ ! $K40&&! ` $ G$ %% <'!',($ Y$ !(@!@!@b$8D$D' .EB$B$0HGI%$)( '$,!@($ 0'` ! $L,,!!@($ 0'03&! `' $ &3%o& 0/-0<'!'  ! @@B '<'!'TPLHD@<840 p(!!!h l S@6( !  !@I5 ! ^$!H )!  (G$!!0 & ! E$! + ("$ TSP!LHD@<840X' ! !@! !(% !8 Q +* ! C$b  P<'!', @!0!8! !(Y$ ,0'<'!', !@@!(!8$$Y$ ,0'endusershellsetusershellgetusershellgetprotobynumbergetprotobynamegetnetbyaddr $0<DLTX`hpx|      ( 8 D'L' |  ( TP(DTP(DXP(DXP(DXP(DXP(DLP DLP DLP DLP D P(P $P(H(dP8\ $P0T(P8\ LP0THP D0PXh  PP0DTP0D |  ( $4TP(DLTP(DdXP(D|XP(DXP(DXP(DLP DLP DLP D LP D $4P(P T$dP(H(dP8\ $P0T(P8\ LP0T HP D08PXh  lPP0DTP0DT(T(X(X( TX( TX( T UL T U $VL TL TL T T(Tp`xR`( 4T4p`x`P\RhlRRP\W\xppWd8 @T@ddddDL`L`R``R`d`Taada$0 8T8``$`<DaDPRPaaRa$aLbbb$b8 @T@ddDdDL`L`R``R``TaaaL0 8T8``L`<DaDPRPaaRaLaLbbbLbH <@R@@R `T``HX` `U`d0dH`dd HVLTV `W`<aHa tt,e,HHe tt$g$HHg tt8b8HHbh4cHc@````@`X``nfP0 4T 8U ,V 0WT0 8T 0U0HX <V 4W0'sgetgrouplistendpwentendusershell'setusershellVgetusershellgetprotobynumbergetprotobyname5 getnetbyaddr ttyname_r ttyname getmntent@ getnetbynamef getgrnam& getgrgid getpwnam getpwuid[getlogintgetpwuid_rgetpwnam_r(TTXXXXLLLL$d$LHPTxx`ddd$$`dLL(TTXXXXLLLL$d$LHPTgetpwuid_rGNU C 4.4.3__stubs_state_ctype_gr_namepw_uid__FUNCTION____page_shiftgroupsgetpwnamandroid_name_to_groupunsigned intpw_name_lbfsize_flagsendusershell_readmodenetentgetgrgid_cookiepw_shellandroid_id_to_grouppw_passwdgetusershell__kernel_gid32_tuint32_tloginstubs_state_tstubs_state_freefpos_tfloatpthread_key_tn_namegroup_name_bufferandroid_iinfo_to_passwdresultlong long unsigned int__sFILEmnt_freqn_aliases_offsetpw_dirprefixsize_tgetprotobynumbersetusershellapp_name_bufferttynamengroupsiinfoendpwentpasswd__stubs_key_initp_namegr_passwdbyte_countfs_path_configgetpwnam_rcharbionic/libc/bionic/stubs.c_extgetgrnamprotobuflenandroid_files/u/raghu/ics_feb29_toupper_tab__closeby_namegroup_membersmntentpw_gidlong long int_base_tolower_tab__fileold_errnogetnetbynamegetgrouplistmnt_fsnameandroid_id_info__kernel_off_tandroid_id_to_passwdFAILdo_getpw_r_writegroupgid_tmnt_optsgetnetbyaddruid_tapp_id_to_passwd__sFshort intlong intgetpwuidgetloginttyname_rn_addrtypenamesuccessfailurerequired_byte_count_blksizelong unsigned intandroid_iinfo_to_groupandroid_name_to_passwdn_netgr_gidandroid_dirsstatemnt_typetypeunsigned char__uint32_tp_aliasesapp_id_from_name__page_sizestubs_state_allocprotoent__sbufthe_onceapp_id_to_groupp_protogetmntentsigned charoff_tshort unsigned intgetprotobynamegr_memmnt_dir_sizedouble_nbufthe_keyuserFILEandroid_ids__kernel_uid32_t_seek_ubufmnt_passnoGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.getgrouplist.text.endpwent.rodata.str1.4.rel.text.endusershell.rel.text.setusershell.rel.text.getusershell.rel.text.getprotobynumber.rel.text.getprotobyname.rel.text.getnetbyaddr.rel.text.ttyname_r.rel.text.ttyname.rel.text.getmntent.rel.text.getnetbyname.rel.text.stubs_state_free.rel.text.__stubs_state.rel.text.__stubs_key_init.rel.text.app_id_from_name.rel.text.getgrnam.rel.text.getgrgid.rel.text.getpwnam.rel.text.getpwuid.rel.text.getlogin.rel.text.do_getpw_r.rel.text.getpwuid_r.rel.text.getpwnam_r.rodata.__FUNCTION__.4243.rodata.__FUNCTION__.4239.rodata.__FUNCTION__.4234.rodata.__FUNCTION__.4229.rodata.__FUNCTION__.4224.rodata.__FUNCTION__.4219.bss.the_once.rel.data.rel.ro.local.android_ids.bss.the_key.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 cV>XLpXQ^p'Z c V npj nV zl(2TT xoPVD T oPV X pPV X hpPVH!X  pPV(!X$ qPV?!L; Xq@VSD"LO q@Ve"La q@V y"Lu r@V"(# XrV$@# prxV&($$ r8V(L$ s@V*$d `shV, `&$ sPV.' tV02)L. tV2E\*HA Pu V4X*T puxV6m,Pi u V8,T~ v V:0-@-P-`-t--/-A-8= (v8VC`.qp.m `wVFd1~ xVHp3v  yp VJpr=4 VLp> VNp~? VPp0vA0oGoGGLY0WP |`    <. =@ >R?d@v A "$$&&B$(E(**,8C.024668:<=>?@ABCEFHJLNPR <d #)ST/( <ETR[`hTuXXXXLLL L"!4;Cd,LS\$.e0nL2wH4P8T:bionic/libc/bionic/stubs.c__FUNCTION__.4243__FUNCTION__.4239__FUNCTION__.4234__FUNCTION__.4229__FUNCTION__.4224__FUNCTION__.4219stubs_state_free__stubs_statethe_once__stubs_key_initthe_keyapp_id_from_nameandroid_idsdo_getpw_r$LC0$LC1$LC2$LC3$LC4$LC5$LC6$LC7$LC9$LC8$LC10$LC11getgrouplistendpwentendusershell_gp_disp__sFfprintfsetusershellgetusershellgetprotobynumbergetprotobynamegetnetbyaddrttyname_rttynamegetmntentgetnetbynamefreepthread_oncepthread_getspecificcallocpthread_setspecific__errnopthread_key_creatememcmpstrtoulgetgrnamstrcmpsnprintfgetgrgidgetpwnamgetpwuidgetlogingetuidstrlengetpwuid_rgetpwnam_rP Q@R`VWXYZ[ \@]`^#$h k@l`mn,qr ???!>%1?>?E?L?S?Z?_?l?s?z?????????????? ??)?>?I?U?c?x??????? ??)?S?a?}??;?F?R?`?n?|????????????#?/?=?K?Y?g?u??????? ??&?4?B?q?|???????9?D?Y?w???????"?:?_?u?  ?????  ?  ;? 0)?048;A?L1X?cgk;t?2?;?;?3?; ? ; ? 47 ?B F J ;^ ;c ?n ;s ?~ 5 ?   ; ; ; ? ; ?   ; ; ?   ;/ ;B ?M Q U ;^ ?i ;s w  ; ?   ; ;  > >     ? # # ? $! $% ;. ?8 ;F ;U ;Z ?a $h ?s &w &{ ; ? ; ? ; & & & & & > & > > ;( ?3 (7 (; ;O ;T ?_ ;n ;w ({ ( ( ( ( ( ( > > ? ) ) ; ? ; ? ;( ), )B )F )Y )] >u )y > > ; ? * * ; ; ? ; ; * ** **!*9*=>O>]?h+l+p;;?,,;?;?;;;;?;? ;?;&;5;:?@,E?O;T?Z,l?v?..;;;;?;??//;?;;";'?1;6?U?a7{???6?8?????? 1 B Wl%]#n$&(?)*+,q./SS T( U @8@ 0<0$ ADASS T( U @8@ 1<1$ ADASS T( U @8@ 2<2$ ADASS T( U @8@ 3<3$ ADASS T( U @8@ 4<4$ ADASS T( U @8@ 5<5$ ADASS T$ U B,B A0ASS T$ U C,C A0ASS T$ U D,D A0ASS T$ U E,E A0ASS _SS, `$ 606( #<#D aL8x b c4 88 _ dSS e 88  SS f F$FP dx g dSS0 4L 7T7p ih $$ d4 j, G8GSS( ,D 7L7 d j GGSS0 4L 7T7p i HH IIh $$$ dD j@ GLGh JpJl HtHSS( ,D 7L7t HHx II d j GG( H0H, J4JSS o( mSS< dt l p p p dH md j` KK d d dSS ,8,SS ,<,     ( 0 8 @ H P X ` h p x                      ( 0 9 $9( 498 L9Pd9h|999999 9$9(498T9X#d9h$9&9(9)9* 9$+89<,l9p.9/ ( 8 Ph(8X#h$&()*$+<,p./    $,0@DLP`dlp ,0?CRVeiqu!15<@GKZ$^$f$j$z$~$$$$$$$$$$$$$$$$$$$&&&&"&&&-&1&8&<&C&G&V&Z&a&e&l&p&w&{&&&&&&&&&&&(((((((((( (((!(((,(3(7(>(B(I(M(T(X(_(c(r(v(}(((((())))))))))))))) )))))&)*)1)5)D)H)O)S)Z)^)m*q*y*}*************************!*%*,*0*7*;*J+N+V+Z+j+n+u+y+,,,,,,,,,,,,,,,,,,,,,,, ,/,3,:,>,E,I,X,\,d,h,o,s,{,,,,,,,,,,,,,,,,,,,,, ,,,#,',.,2,A,E,L,P,W,[,b,f,u,y,,,............/ / / / /# /2 /6 /= /A /P /T /c /g /   (08@HPX`hpx#$&()*+,./  $(,04@&D&H&L&X&\&`&d&p&t&x&|&(((((((())))))))))))*** *** *$*0 4 8 < @ D HLPTX\`dhlptx|##$$&&(())**++,,..///579 1331265336 1002 1002 100644 16124 ` ELF#P4(2/((88(0% RU$ > $ > $ > : ; I: ;I I&I  : ;  : ; I8 : ; I8 I !I/  : ;  : ; I5I.: ; ' I : ; I4: ; I4: ; I  .? : ; ' I@ : ; I4: ; I.? : ; ' I@ : ; I4: ; I 1RUX Y 1 U!41 "41#41$ %4: ; I&4: ; I '&I(4: ; I )4: ; I? < *4: ; I?  )`\vDintWLn a0>LAp ( fd)E# *7# +7#P!> P $# %P# ` } wGE n   # ^ #  }k      }  }  } ,   # $$ $[  @.# = A # B>#$ %f $ %  4 # = 5 #  6L#  7L#  8# toc 9#  &  &  cmd GL#  H.# I>#$L L } L. } > } N }[tEmsgk`sErEE_rcE_rc_rcE  }& U1L1n\Lpa^<7[5E<pi1\nLppa<X 3EkeyerrE`EEmsg~N4_ !j}!u}""#""$Xa#$<Pt"" IEpi|1|:|X%=~Lvlen~L >1ygpai<%jLtocky!lenlL?pim] @%jpLL /E\pi17E(4'pa9<s:Efd:ETsz;Lenv<}& .C',& /C x }(%1h(L3L)L)gL* 5<' bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/kernel/common/asm-genericbionic/libc/include/sysbionic/libc/include/netinetsystem_properties.cstddef.hstdint.htypes.htypes.hpoll.hsocket.hsocket.hun.hin6.hsystem_properties.h_system_properties.hin.hunistd.hv~$=t=(PJquvKtuM<JJ$< <XKKJJ<4 =HIK󻃿,4MGINLQxJ J}z,u>EM 7$tKht=$$~<'!BE+ `$P !HJ$<5$0!F!<'!'$ ! $! @!( !0 $$! ('Q02&! @!( !0#p$! ('ANDROID_PROPERTY_WORKSPACE<'!'$ ! !$$ ('U !  B,@ ! @\C,`'! !( $$!(' $ !(@' \$$$ !0@!@ '! @!( n$"'$ l$ !(@!  $@$$! !( $ !8S D ! $R&$F'$$! `$ $R G ! !<'!'40,($ !!!$$ $! @ !0 %0@!! !( f& #p!  !( 4!`0,($ 8'<'!'40,($ Q! <4!@6 0&! !0`&$!2s!(@  @4!@0,($ 8'&!<'!'$ ! @@!0$!( ('$('<'!',($ $b!,($ 0' $@!@$ ! @! ,$ !@@ D$$! !(@$ !@$FOP <HPR'5CE < KvO5j! @ !( $/dev/socket/property_service |  LP(P PT(P8`(P8`\P(D(P0P |  L$P(P DPT(hP8`(P8`\P(D(P0P 0TDLT<RDDR( <T<dapT0h`|`xa 4T4L`L`T``T 4U4DbDTUTbUb8<RRR48R8L``R``RRR8 LTLa LULf LVLeL`Lc8 LTLee@aaTdd```Xcc`|bbb`WW\( $T U<DUP\U,4T4LRLPRP\T(0<Hbpxb(b@LahxaxRa__system_property_find_nthB__system_property_wait__system_property_set__system_property_read__system_property_find__system_property_get__system_properties_init__system_property_area__LL\(4848X\p`hL\(resultversiontries__system_property_findin6_addr__system_property_waitdummy_props__system_property_setssize_tshort int__system_property_readvalueprop_info__u32__system_properties_initfloatnamelenlong long intu6_addr32long intaddrprop_areasockaddr_unreventsin6addr_loopbackbionic/libc/bionic/system_properties.csa_family_tunsigned charentry__be32socklen_tsigned charlong long unsigned intunsigned intu6_addr8__system_property_getpollfdsa_data__page_size/u/raghu/ics_feb29charprop_msg__system_property_area__property_service_socketserialshort unsigned intsize_tsun_path__page_shiftsend_prop_msgalenpollfds__u16__u8long unsigned intin6addr_anydoublesun_familycountsa_familyupdate_seenu6_addr16nameeventsmagicGNU C 4.4.3in6_ureservedsockaddr__system_property_find_nth__be16GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__system_property_find_nth.rel.text.__system_property_wait.rodata.str1.4.rel.text.__system_property_set.rel.text.__system_property_read.rel.text.__system_property_find.rel.text.__system_property_get.rel.text.__system_properties_init.rel.data.rel.local.__system_property_area__.bss.dummy_props.rodata.property_service_socket.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 080>8Lp8^pMZ 10 np j 580 ~Lz 50  6(02  <60 6(0 7(05\1 47 0U(Q T7p0x$t 70(( pH 7p0 < <880"p0 t8@0$p =0&pP =@0(+p!' =0*9p0HD0 !Mo!+!]X+1# 8/   (@ "$&(*,LQ-.VL qz !(/FM\c(|bionic/libc/bionic/system_properties.cproperty_service_socketdummy_props$LC0$LC1__system_property_find_nth_gp_disp__system_property_area____system_property_wait__futex_wait__system_property_setstrlenmemsetstrlcpysocketconnectsend__errnoclosepoll__system_property_readmemcpystrcpy__system_property_findmemcmp__system_property_get__system_properties_initgetenvatoistrchrmmapmunmap# &@(`2578 !%,3:AOV]dkry(4Balx %1?M\gsOkv  ,DO S Wiv{     <K O \b f u y  $)3BQ_dis "(DMy%4 J s $Tm$$ %$$4 'p % '$$\ )t ) * + + , *$ +  (< -` . / 0  1 / 0$$L 'p 3 4$$4 %8 )` 6$$ 54 2$$$ %( 0X 98 `x : ; : < = = $( DH hl ( H l     " ) - < @ H L \ ` g k r v                       ! % , 0 7 ; B F M Q ` d k o v z                     '+:>EIX\cgvz!%,0?CJN]ahlsw !%48@DTX_cjn}   (08@       $ ( , 0 4 @DHLPT` d h l p t x|time64.o/ 1331265336 1002 1002 100644 31432 ` ELFMP4(EBH@8P X((% RU$ > $ > : ; I$ >  I&I : ;  : ; I8 .: ;' I  : ;I 4: ;I .: ; ' I : ; I4: ; I&I.: ;' : ;I.? : ; ' I@: ; I4: ; I.: ;' I@: ;I4: ;I1RUX Y1 U411X Y 1RUX Y 1X Y!.? : ; ' I@ ": ;I#4: ;I $4: ;I%41&.? : ;' I@'4: ; I (I)!I/ *4: ; I+4: ; I,4: ; I U /into6q6^tJY7S3ldtm,-j .)# m/)# 0)# 1)# m2)# B3)# 4)# B5)# 6)# 8l#$ "9#((GjH   I! y" # >)S) |) t tm ))G tonsrco onsrc n ,u ` ! ) u j)5uZt!uJu΀%πj)4B)Xb!B4D)  E4`K(8R8@PVh0t,x  (,<:!*/t*n "p n/# ) #[ )#? )6 )c ) uT )$muauj)u!;,n+n\dnn#{#@ %)!-n 2< ]3\ A T #t@6ur  #{~#tu #nP% !7utl &n // n a 5&Jn // nB av 'N()"'O())) '_Q'V( ))'[$ (? ) )'d_P ) ()e )''dv U *Dg+iY`() )'s  '~  ,S p C bionic/libc/bionicbionic/libc/includebionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/include/systime64.ctime64.h_types.hstdint.hposix_types.htypes.htime.h<=IL ~(J8<(J,EELHGMLLKGHLIKyJQi< tiuJw(J~,J~~JJ~JJ~,zotuIIKIL~ 8FN[䅃#]<#J~<$$~J~J$uP vJ \($Jk(H=P tJ g(R<?#tNNY'@r  Jx<d<hJG}LP` J;K;KzPuO=KIIKN0K4H:HLGDHIKKH oJD0 $  KKQvJIOvJKKKKPE,gtLHL=OP#;(t~ K0<dwIFNEOEOE=IK,HHLG@xRxRxJRuKKIKHI(qh< <x $ $vq~N}LFLK}<HEO <R uIM<LBDKIKJ@JHLHLHXJ(JXJv=ILIKR|((J|H|J|<?G(,HJ sJ Jc,ptZxvIIKILIK uLy,uLy,<'!'D@<840,($ ï!e.@$&+($$ !8Ya!Hl<:4P !@*R#+¯#!`l&+H!@5$$!! !( $ !8%PCc@2$!PI&!I' +!d+r!0!pQ!!!`!n+!! !($ !8%CS$y0#!.X%!v %!Ȋ/Ç !+x$ <#>!2!pQ4!H+X#`C#h!v!x(ç PsG !+ !0!H+!"!x!!pED!N+F!@<840,($ H'! !( d$!8!0 %XC+0 3 !(! d$ !8%C!$P.!l!eG.F$f$!&! !( $ !8%C-2$&@>&!P+0!>I!8#I! ''#b+x_+%&#!(e!0@*h! !!+`! l&+!! !($ !8%C`3! !( d$!8!@ %`C+@ &+'$ !8!C<!:q6#hQÇ+x'p#!@F$l&/!<'!'<840,($ M$!$+ D!`!CB,g@<0&+p !u&+0&!! !(`d$ !8! !(`p$$!@ !`!hW!v+x!pQ Yg %H!P+!@1!! !( d$ !8%xC ! !( $ !8%C`&+(p!! `!(@d$ !8%C !(@! `$ !8%C'@! !($ !8c(S$+  cP%<!HK"840,($ @'!840,($ @'&+8!!! !($ !8c(S$  c .%<!T"840,($ @' &+ !! .f! `!(d$ !8&! `!(+pp$$!`!@ !!PW!hu+`B!XA O %(!!b+g!%.3s %.3s%3d %.2d:%.2d:%.2d %d UTC<'!'40(C,`! e,@(!4!08' !`@!Xl*%%$ !0!8E$ ! 4<'! $<'!'LHD@<840,(b$($ ! <$!8! !(! !(<$!8  ! @!(`<$!8!@ !`! `!(@<$!8 ! @!(`$!8!@ !`! !($!8   !@D&!`+!($ !8!@N$O(  P&+?&!_l$!Lpq^pY Z ^XC npGj fpC ~,z fC X gC2L$p gHC0 g(CL hHCH( hi(Cd(\ iHC* i(C4*<0 j CF+\B j C Zt+V @j`C"mH0i jC$`0 jC&1 jC(11$2p2p22`1\3`N3,f3$p3 jC35 kpC5pD7  8l C7pB HxC9pC PxxC;pDD8 xC=p0|Eg0IoIJ WD8 \   .,`0AXKp-[p,j$+s*}#2`/,1 "$&(*+,-./0123579;=? @A  \)5A<I\ S"\c$o&}(bionic/libc/bionic/time64.clength_of_yearjulian_days_by_monthsafe_yearsafe_years_highsafe_years_lowmon_namewday_nameStatic_Return_Stringdays_in_monthStatic_Return_Date$LC0$LC1__divdi3__moddi3timegm64_gp_dispasctime64_rsprintfasctime64gmtime64_r__errnogmtime64localtime64_rlocaltime_rlocaltime64ctime64ctime64_rmktime64mktimetimelocal64fake_gmtime_rgmtimefake_localtime_rlocaltime:  @<`>?ABDE F@G`IJL 111!0%31:1A1H1O1T1a1h1o1v1}111111111111$121@1N1\1k1v111111111111)1;1H1b1u111111111  -1-1!-&10-51@1J-O1[1g k o-x1-1-1- 00     00#1.26-?1J-O1Z-cg}11-1-1--111%10-51@-E1P-U1`-n-s1~-1-1-11-1-1- 1-1$-)191H1T1_-f1qu1-1-1-1-1-1-11!-*15-:1J1Z1e-j100-11-1  -1 -1-1*-<1H!L!P-Y1d-i1t-y1-1)1*1'1( 1 "@ 1L #f 1r &| 1 1 1 % 1 $ 1 Y 'HY -!;;` 8 && 9P 9 (( 9 9  &,&0 9 9 9 9L 8;; 8 8 9 9@ 9h 9 9 %p %%, 9t $d $|$ 8 8;; =l ""h ##x 22;; < **;;H 9< 3L3| 8 9 8 9 8D 9 8( 9T &\& 9 ' ' 't ' ' @ 9( (0( 9 9  9P 8 && '' 9 && 9 ''H 9 9;; ? ));;H ?p ?t C : C 4 ;; B ));; D, >;;$ B< <;;  $ H 8  9L &T&| H 9d 8;; G;; K;; M+ H+L x+|++++ ++ 4+8T+X++ +! L | 8X !    ! % , 0 7 ; J N Z ^ j n z ~                   * . : > J N b f n r                     ! % 4 8 D H T X d h t x   /3:>EIPTcgnry}  ,0<@LP\`lp| "&-18<CGNRaequ!%15AEQUaequ!%15AEQUaequ $(/3:>EIPT[_nrz~   $ , 0 A E T X _ c r v ~                    $ ( 4 8 D H T X l p                       ! ! ! !/ !3 !B !F !M !Q !X !\ !c !g !v !z ! ! ! ! !  (08@HPX`hp x!        ( , 0 4 8 < @ D P T X \ h l p t        $ (!,!thread_atexit.o/1331265336 1002 1002 100644 3988 ` ELF8P4("% RU$ > $ > $ >  : ;  : ; I8 5I: ; I .? : ; ' @ 4: ; I Qintd?{)*#)+ )) $ "Z bionic/libc/bionicbionic/libc/includethread_atexit.cpthread.h)$<'! $<'! $ |    |   $@_thread_atexit_unlock_thread_atexit_lock$long long intunsigned intunsigned char_thread_atexit_unlocklong unsigned int/u/raghu/ics_feb29long long unsigned intfloatpthread_mutex_t_thread_atexit_lockGNU C 4.4.3bionic/libc/bionic/thread_atexit.clong intgAtExitLockdoubleshort unsigned intsigned charvalueshort intcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text._thread_atexit_unlock.rel.text._thread_atexit_lock.bss.gAtExitLock.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5  >Lp^p!Z np j  ~z (  ( p0 $ 0 D p(D T pl( \ p t !p0$,05oE ! H    $0 FOdxbionic/libc/bionic/thread_atexit.cgAtExitLock_thread_atexit_unlock_gp_disppthread_mutex_unlock_thread_atexit_lockpthread_mutex_lock  !%3:AHOV]dkry     g w         $ (  (       utime.o/ 1331265336 1002 1002 100644 4216 ` ELFP4(!,0% RU$ > $ > $ > : ; I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I  I &I&II!I/ (int;Dg.43ay4acd##YR##%)P] #*] a+h3 tv-wh tvp-Q c nY}  bionic/libc/bionicbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxbionic/libc/includeutime.cposix_types.htypes.htime.hutime.hutime.h+wIKILM <'!', $' ,0' | PP0D | PP0DP0 DT <U<DU<DUutimePPbionic/libc/bionic/utime.cshort unsigned intfloat__kernel_time_tunsigned charactimeutimbuftimeslong unsigned int__kernel_suseconds_tdoublemodtimetimevalunsigned intlong long unsigned inttime_tutimetv_usectv_seclong long intGNU C 4.4.3charsuseconds_tshort intlong intpath/u/raghu/ics_feb29signed charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.utime.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pIZ 0 npj  ~Pz  p$( L( ptd `p Pp  Xp hp0$G0ko}   L2   P "+bionic/libc/bionic/utime.cutime_gp_disputimes !%3:AHOV]dkry   #- 2< X o          $ 3 7 > B Q U    utmp.o/ 1331265336 1002 1002 100644 12464 ` ELF`!P4(+(   % RU$ > : ; I$ >  $ >  I : ;  : ; I8 : ; I8 ' I I &II!I/ .? : ; ' @.? : ; ' I@: ; I4: ; I.? : ; ' I@.? : ; ' @ 4: ; I 4: ; I !I/Yiint;sA43)e+#$4^> wj")3w4wCHcdNW< X<# )Y)#ITwd _px<# _ry)# _wz)# {P# 5|P# _bf}# B~)# # t# #$ #( y#, /#0 _up<#8 _ur)#< #@ |#C _lb#D )#L #P )t d ) )z   ) )  ) IIB\9 # #IY 5 K 6P# 7P#` <)  =P#  >#  ?9# ; @)#  A9#  BI# T DY#,  Fw#0 T G#4 I9#< c JI#L9IYFH T) dO@lenQ0Z Vi U4-ut.M/$ bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxutmp.cstddef.h_types.hstdint.hposix_types.htypes.hstdio.htime.hutmp.hL?uIKw J :$Lz$EO 2<'!'  '<'!' !C,`!(x$$!( $ $ '! 'r<'!'&`$ $$C& '$ $!8@@! '<'!D!( !0/var/run/utmp | HP HP HP H 4 | HP H0P HLP H h4H  (T(x`` B#Yendutentnutmpnamegetutentsetutent4H4H4e_exitsize_tut_user__kernel_suseconds_tlong long unsigned int_lbfsizee_terminationGNU C 4.4.3long long intsigned char_ubuf_basebionic/libc/bionic/utmp.cut_addr_v6_cookielong int__kernel_time_t_flags_blksizedouble_offsetoff_tsuseconds_t_readfpos_tunsigned int_closelong unsigned int_fileut_idshort unsigned intut_exittimevalfname__kernel_pid_t_writeutmput_hosttv_secsetutentut_sessiontime_tutmpnamefloatint32_tunsigned charexit_statusendutentshort int__sbuf__sFILEFILEut_typetv_usec_seekut_pidchar_size_ext__int32_t__kernel_off_tutfileut_tvgetutentunsed/u/raghu/ics_feb29_nbufpid_tut_lineGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.endutent.rel.text.utmpname.rodata.str1.4.rel.text.getutent.rel.text.setutent.data.utfile.bss.utmp.bss.ut.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 P+ )>LpG^p#Z p+) npB(j 0. ) ~l Hz P.0)   .8)2H L  .p) 4 (/() `pt P/@) t / )p /)&pF" @0):p86 H0()!Mp(I p0@)#[p0/f0oo(*  *   %`!#%*&'/H 8AHQX`iou4~bionic/libc/bionic/utmp.cututfileutmp$LC0endutent_gp_dispfcloseutmpnamestrlenstrlcpygetutentfreadfopensetutentfseeko #@&`) !%1>ELSZ_lsz  .Cv,HV+Zft [b f jp{    !!  ( "4!! $H %D L` !!  0 '4, Pd (( h` p!!  * 04 LPhl 4 Pl     $ , 0 @ D K O V Z imuy  (    gethnamaddr.o/ 1331265336 1002 1002 100644 58288 ` ELFLP4(@=PH`?P(00@X`% RU$ > : ; I$ >   $ >  I  : ;  : ; I8 I !I/  : ;  : ; I : ; ( &I!I/ : ; : ;  : ; I 8  : ; I 8  : ; I8 ' II : ;  : ; &I<  : ; I : ;  .: ;' !: ;I"4: ;I#4: ;I$ %.: ;' I &: ;I'.? : ; ' I (: ; I).: ;' @*: ;I+: ;I ,4: ;I - : ;..? : ; ' I@/4: ;I01RUX Y1 U2413 14: ;I54: ;I64: ;I 7&8.: ; ' I@9: ; I:: ; I;4: ; I<4: ; I=4: ; I>4: ; I ?4: ; I@4: ; I A : ;B C UD1RUX YE1F G41H41 I.: ;' I@J1X YK4: ; I L4: ; I? < 0int;=2bF *4;5)4k/qC3W5iQ Ib;Lz Cp tI ub v; wG y !b    $P# ] %#   G)  -  .#   Q P#  b# m #  # I   9 9 I Y I  Y  i  Q  - #3 ^AtI| I2bj i Zr 9 7 Z    $ S$  !""#$%&'2()r*r G )$=t w =  ctidd;#rdu;#tcv;#aaw; #x; #qry;#c {;#cd|;#ad};#~;#ra;#R;#;# ;#;#tU(N W nX# CY)# lTw_px#_ry)#_wz)# ?{P# |P#_bf}# ~)# # # $#$ 0#( @[#, #0_up#8_ur)#< a#@ q#C_lb#D e)#L #P)))0))PP)V6 Iq  I  T U# V# W)# zX)# Y# vd* e# f# 2g)# h# [\! # # ,# h#B  #B )#B `P#B v#B ,#B  #  "  E  0jC F| rk mY _ C     )  *)Dq  C  ) )  [ # |#T # T # d #extz # d  )t t 0 pad   /\#+ )# t)# :# )#  #id$#@ & #D  #` :#~;# ;# $ # 4 # N # Q # )# )# ?/# e/#_u # D #     $ 4  D 0T `_  Cfo{  ) e  u srcvP# wp # x# y  1P# #j X+ hdrYtbufZ+ <  [  !ap!num)!resT "i)"j)"p# #)$"hp P " !hp!bpp!ep"ap$"i) 4"rs %WB&1BP!afB)"pD#E"ptrE"cpE"numF)"lenG0"rsH $#Z0"src['_)(c))HA*srcP +dstU,p R,tmpAx"i) Q %"p"cp"q"af)"len)"rs -F$"resT .|3I/rs T0QP12cg2m2x22X23102.4*len3*af)g5I5/hp67  8h c9Kc99)9P9):resT ";hpnap 􀄄~SJKPyJKP={zJPEO~( d~*J~JJ~JJ~(<AIKL?$IKAjJ't OIKIIKIJyJ_JIILH vJKvJJ{0KIKK 0<{I,CKFKNIKvJqJ{0<t~<(xKKIKK=KjJ/$y${ t,(\LeJIKK<zJOKLxJNN<g<$( KKKGLKKHLIK(zJPzJL $ +J^0x>KGLKm@0zJ |<(JyJIRCvcJKJd|<?Jf<=IKTFN[$OzJKLzJOLKKqJJ$8"@ JEOzJKKKKKHM-|JEKNEOKIwJIKIKLPwJ|^5t|JvuHLN ${uHLw<urJJ==>H=LzKI$IJMKGKIKL=HLyC,%t[HPFJMIJJJr.$IM$7IJ7JJKGGKzK=J:JOKoH' $!@B$C$ $'/system/etc/hostsr# hostsgethostbyaddrgethostby*.getanswer: asked for "%s %s %s", got type "%s"%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpagethostbynamefilesdns<'!'LHD@<840,( T!@ P!@,!F!@2&! @  $&&&!6&#$ @!@BS,!&! @  $@!@ $F!LHD@<840,(P'!  !(@@!  !(@G$@ $!(!0 W@$ $P!"N@T!"@CT!#6P!0 X!1 $ $%!(`DC%0&H!%! L!0 '@@B$'4& $ $! @!(A@+0C>` s r& 2@@B$$ $!0@r@,!" $C!P{,!&!($ !0s@ |@I (1 $$$ ! @ @iH!"&! !(!  $ <'!'D@< $!$7$  |$C $E!D!`@<H'$ $$   $6g$`$ <M@ @>Lp^pZ ؝> npM!, j x`> z|-H2-.| ح>2 Ю>3h  `>4? >Bh >!,G 0>:G6 8@>RHN x >l|K X>!P x>#V 0>%W$ @ >'$W0TW$ ` >*0xWCWZpWV >.kYg @`>0ypx[u $>2plxl >4pxx h>6pPy( >8p0x} 0GoYiL?? ̚   "H 3%E$'Oh Y/)ev,h$*@-!!##%')*,-.02468: (8t ;<|$5;CQ[aq */7>FNZiwbionic/libc/netbsd/gethnamaddr.cmap_v4v6_addressdefault_dns_filesdtab.4296getanswerAskedForGot_dns_gethtbyaddrCSWTCH.126gethostbyname_internaldtab.4210_dns_gethtbynameCSWTCH.129_gethtbyaddr_gethtbyname$LC2$LC3$LC0$LC1$LC4$LC5$LC6$LC7$LC8$LC9$LC10gethostent_gp_disp__res_get_staticfgetsstrpbrk__get_h_errnoinet_ptonfopen__res_get_state__res_put_stategethostbyaddr__errnonsdispatch__res_hnokdn_expand_getshort__p_class__p_typesyslog__res_dnokstrlenstrlcpyabortstrcasecmpmemcpysnprintfmalloc__res_nqueryfreestrlcatstrchr_ctype_strncpy__hostaliasgethostbyname2gethostbynamegethostbyname_r__res_nsearchrewindfclosememcmp ?@I`abc @`! ///!.%1/>/E/L/S/X/e/j/w/~/////////////////%/0/;/F/Q/\/h/v//////////#/./j/v/////////////////// /&/,/2/8/>/D/J/P/V/\/b/h/n/t/z///////////////////////////#/*/3/@/F/L/R/X/^/e/l////0/A/R/c/u//////////*/8/F/T/b/p/////////////////1/>/L/[/j/y///// /% /+ /1 /7 /= /D /O / / / / / /* /8 /u / / / / / / / / / /, /; /M /_ /n /} / / / / / / /U /f /q / / / / / / /= /H / / / //5/G/h////  + +R///  ++ ..+ +++%+.+8.A+K/V Z ^+g/r+++/+/++/$/+/+/)+./8+=/G+V+n+{++/+++///+// +/+!/,/;/J/b+g/nsw/+...+..+4+9=F+NR/++/++/++)+./9+X+]/h+x++/+/+++++$//+>+C/I/_+d/q&z~..+./+/+ ++,+3/>BF+O/Z+i+y+/+/+++/+/+/++/"&+9+>/I+X+r+w/++/++//+ +/+,+:+?/Y+v+..+..++++++.+ .."+*/6!:!>+Q+V/a+p+/++!..+++++!. .+ !$.0.9+B+K+T+]+f+p.y+!..+!!++////&%@/L#V/c/{/   1   !@@< AP Al Bt 001|  C B D4 CT E Cx 11P 11$ C F 22 33 D E G H8 D@@< JP D J D DP K0 #T#D 4\48 $d$H 5h5 D D@@< A L L M M4 NH N\ N( D O P P Q 66, R8 D S M R8 Sd T U   D VD S W S T V Q %% D Mp S S T M LH S Q| % %@@< Ax U X 77 Y G Z 0D [\ W H D 88  XP \L 9T9p D D [ H [ H  @ HP Dx ''@@0 A\ Dp J ] ^  ^8 ] D S K ## && 44 ::< E\ _| D D E _| D D D  ( D, `D Dd D@@ GD H\ H@@$ GL Pl HH @@ b4 D@@H Y G d  [ HD Y` D [ H [ D( (0(@@< A` A e 001 A B C B$ D@ Al f C Ex C 11 11 C F 22  330 Dx Fp 2|2t 33 D E G H D8 gX A l @@< AX Ax e 00 A B C B D$ AP ft [ J D D C$14 E C 110 11 Cl Fd 2p2h 3t3 D W [ F 22 33 E G H( DL AT Vx V A S S Yp W D        !  ) (), \)` |)))),)0L)Pl)p))! , ` 0Pp!     $ 3 7 ? C T X g k r v }                          $ ( / 3 : > E I X \ c g n r y }                        $ 3 7 > B I M T X g k r v }                      $(9=DHOSZ^eipt{"&.29=EIPT\`gksw~ !%,07;BFMQX\cgnry} &*15<@GKRV]ahlsw~ $+/6:AELPW[bfuy%)04;?FJQU\`gkrv}    $ ( / 3 : > E I P T [ _ f j y }                             & * 1 5 D H O S Z ^ e i p t {                          * . 5 9 @ D K O V Z a e l p w {                         ! % , 0 A E T X _ c j n u y                         $ ( 7 ; B F M Q ` d k o v z                      (,37>BIMTX_cjn}  #26=AHLSW^bim| &*15DHOSZ^eix| 04;?FJY]dhosz~ (,;?NRZ^eiqu &*15<@GKZ^eix|   '+26=AHLSWfjqu| $(9=LPW[jnuy  '+26EIPT[_fjqu| #'.2AELPW[bfmq  '!+!3!7!H!L!S!W!`!d!l!p!!!!!!!!!!!!!!!!!!!!!!!"!&!-!1!@!D!K!O!V!Z!a!e!l!p!w!{!!!!!!!!!!!!!!!!!!!!!!!!!!"!)!-!4!8!?!C!J!N!U!Y!`!d!s!w!~!!!!!!!!!!!!!!!!!!!!!!! !!!!!!(!,!3!7!>!B!Q!U!\!`!g!k!r!v!}!!!!!!!!!!!!!!!!!!!!!!! !!!$!(!/!3!B!F!M!Q!X!\!c!g!n!r!y!}!!!!!!!!!!!!!!!!!   (08@HPX`h!       $ 0 4 8 < @ D H L X\`dhlx| (,048<@DHLPT`dhlpt  $048<H!L!P!T!X!\!`!d!h!l!x!|!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!! !$!(!,!0!4!8!<!@!D!H!L!X!\!`!d!p!t!x!|!!!!!!!!!!!!!       !!ev_timers.o/ 1331265336 1002 1002 100644 8676 ` ELFP4(*'00% RU$ > $ > $ > : ; I : ;  : ; I8  : ;  : ; I I !I/ .? : ; ' I@  : ; I : ; I 4: ; I4: ; I.? : ; ' I@4: ; I 4: ; I 4: ; I &I4: ; I? < 4: ; I?   inti$q9/k3a4a> L0cdJ#Ba#a<##f f v  v }  }  }CG<# F secFUFaVxG 7O@3OMO xP \Pu\\ x] j)0 aj bjxka , tvts U4 tstvvYnowh3pSs>nowth3vpmw)_.C6/ 0L 0# )+ bionic/libc/netbsd/iscbionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetbionic/libc/includeev_timers.cposix_types.htypes.htypes.htypes.htime.hin6.hin.hunistd.heventlib_p.hOKKIKGIMKMKFLKzOKL$ FN=9v=: v J=9v=:$NetBSD: ev_timers.c,v 1.2 2004/05/20 19:52:31 christos Exp $!; XLpXP^p Z x( npj L@( z> @H P 0 , 4(  0(   8(p  (0H , t @(>p ^: `(MpN I !(ap X] !H( tpNHp d!("p0Y0oH)     "$%&$1@=PI0U,b4nzbionic/libc/netbsd/isc/ev_timers.c__evConsTime__evAddTime__evSubTime__evCmpTime__evTimeSpec__evTimeVal__evUTCTime_gp_dispclock_gettimegettimeofday__evNowTime__evOptMonoTime @` !"#' !%3:AHOV]dkry .EP[    5@ D P^w  !,04K[fjn(8 K f  $$ %\ &t ! $$ ( %d &| !  $( 48 DH TXdhtx ( 8 H Xhx    "*.>BJN   ( 08@H        $(,048<ev_streams.o/ 1331265336 1002 1002 100644 4664 ` ELF| P4(!t% RU$ > : ; I$ >  $ >  : ;  : ; I8  : ;  : ; I I !I/ .? : ; ' I@: ; I 4: ; I 4: ; I &I4: ; I? < 4: ; I?  $@Cpint;m9ggL+(;;IW;^#!# ) ) {9 I 9  I  Y t%# 2buf2Ucnt20Vret3x.Y/ ;Q ;) ) bionic/libc/netbsd/isc/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/netinetbionic/libc/includeev_streams.cstddef.hposix_types.htypes.htypes.huio.hin6.hin.hunistd.heventlib_p.h1JP$NetBSD: ev_streams.c,v 1.2 2004/05/20 19:52:31 christos Exp $'!' | D | D4(t__evConsIovec__evOptMonoTimelong long intsize_t__u16__u32iov_len__evOptMonoTimeshort intbionic/libc/netbsd/isc/ev_streams.cfloatunsigned charu6_addr16long unsigned intu6_addr32short unsigned intu6_addr8__be16__be32doubleiovecin6addr_loopback__page_sizein6addr_anyunsigned intlong long unsigned intin6_u__kernel_size_t__u8GNU C 4.4.3char__page_shiftiov_baselong int/u/raghu/ics_feb29signed char__evConsIovecin6_addrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.ident.text.__evConsIovec.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 h>xLpx^p|(Z p` npj  zk?p$ $ p    p,8 pd  p (p00:oL\   $C   %3bionic/libc/netbsd/isc/ev_streams.c__evConsIovec__evOptMonoTime !%1>ELSZahov}Zfv    #           nsap_addr.o/ 1331265336 1002 1002 100644 7372 ` ELF<P4($!% RU$ > $ > $ >  I: ; I : ;  : ; I I !I/  : ;  : ; I8 &I.? : ; ' I : ; I.: ; ' I .? : ; ' I@: ; I 4: ; I4: ; I1RUX Y 11X Y .? : ; ' I@ : ; I4: ; I 4: ; I!I/4: ; I &I4: ; I? < WLPint>D%8cR>L0t>v0p$  } $ } 4 } O #U ` )c)x)c)o)c)z.c.)/h3ZTh3eU3)Vc4 nib4len5jkHC^}LIwh0F,8K&0&Z)hZOUZnib[)i\)5]& ^ 7},.S4/S<8Z9 E:p# bionic/libc/netbsd/inetbionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/arpabionic/libc/include/netinetnsap_addr.cctype.htypes.htypes.htypes.hin6.hinet.hin.h2CJc'JJyJ JJJLnJBJhJJLp^pLZ ,0" nptj \" ~lhz l "    " p 8  " 8 "p  @"p2 8 "pj ( $"p h <"$p0 /08oH# n   % 1h @IQ_bionic/libc/netbsd/inet/nsap_addr.ctmpbuf.3370inet_nsap_addr_gp_disp_ctype__toupper_tab_inet_nsap_ntoa  !%3:AHOV]dkry5Am  'AJ Nc g|      !8T]y0  H L     , 0  0      $ + / 6 : A E L P W [ j n u y                              $ 0 4 8 < @ D P T X \ __dn_comp.o/ 1331265336 1002 1002 100644 1053 ` ELFP4( GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.pdr.mdebug.abi32.debug_abbrev.debug_info.debug_line.comment.gnu.attributes@!@'@,p@5X:XHpXVpYbpYn0Ywok{\     __res_close.o/ 1331265336 1002 1002 100644 1053 ` ELFP4( GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.pdr.mdebug.abi32.debug_abbrev.debug_info.debug_line.comment.gnu.attributes@!@'@,p@5X:XHpXVpYbpYn0Ywok{\     __res_send.o/ 1331265336 1002 1002 100644 1053 ` ELFP4( GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.pdr.mdebug.abi32.debug_abbrev.debug_info.debug_line.comment.gnu.attributes@!@'@,p@5X:XHpXVpYbpYn0Ywok{\     herror.o/ 1331265336 1002 1002 100644 6880 ` ELF P4('$P% RU$ > $ >  $ > : ; I I : ;  : ; I8  : ;  : ; I I !I/  : ; ( &I.? : ; ' I@ : ; I.? : ; ' @4: ; I 4: ; I4: ; I &I4: ; I? < 4: ; I?  i2int bu-@(0p> L0 }# # * * (: J :  J  Z u 2#P ^ Z8U Derr) h8sb?iovc8Hvc]td{ H ].dZ/d00  uT[)( bionic/libc/netbsd/resolvbionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/netinetbionic/libc/includebionic/libc/privateherror.cposix_types.htypes.htypes.huio.hin6.hin.hunistd.harpa_nameser.hnetdb.h (MG J$TAHLKFMKKowKIK Resolver internal errorUnknown resolver error: Resolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with name<'! (`0!($B$<'!'LHD@<';' '!   D@  D !@ DE ! `! @ B#H0 %$B$!(  $LHD@<P' 0'! @ $$ $(''8Td |  D hPPT |  D $hPPT 0T8DTh TT$,THb`hbR@hstrerrorherrorh_errlisth_nerr$DhDh__page_size__u16__u32iov_lenns_s_qdu6_addr16bionic/libc/netbsd/resolv/herror.cns_s_udin6addr_anyGNU C 4.4.3long long unsigned intunsigned charlong unsigned intu6_addr32short unsigned intu6_addr8hstrerror__be16ns_s_ar__be32doubleiovecin6addr_loopbackh_nerriov_baseunsigned intcharin6_uns_s_ns__kernel_size_t__ns_sectns_s_prlong long int__u8h_errlist/u/raghu/ics_feb29ns_s_anherror__page_shiftshort intlong intfloatsigned charns_s_znin6_addrns_s_maxGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.hstrerror.rel.text.herror.rel.data.rel.ro.local.h_errlist.rodata.h_nerr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 %>LpR^pZ % npj % z2`D 8%\h 0% (%pD  % D %pd  %p D  %$p6 (  %7p^ 3  %Ep0v P0c You  i`& h   !$ ) .4 30 "#8DBKUh\cqxbionic/libc/netbsd/resolv/herror.c$LC1$LC0$LC3$LC2hstrerror_gp_disph_errlistherrorstrchr__get_h_errnostrlenwritevh_nerr   !%3:AHOV]dkry [gv     &3Ien%5 K  , 48 @8 !H "X l "|  "  ! # $ 4 #H P      $(  (      " * . ? C J N ] a h l {        res_comp.o/ 1331265336 1002 1002 100644 11908 ` ELFP4(30 (% RU$ > $ > : ; I$ >  I : ;  : ; I I !I/  : ;  : ; I8 &I.? : ; ' I@ : ; I 4: ; I U4: ; I : ; I4: ; I4: ; I.? : ;' I@ : ;I.? : ;' @ .? : ; ' I@: ; I: ; I 4: ; I &I4: ; I? < (?4(intU2d2WY40> m3L5^>W0\+Kt>yz;;K[ K  [  k  " ,#  v)dnTpch)ch)4nch)S)L&dnǑR2)jdn֑pch))b),dnTch)src+src7srcdstqsrc dst )d1ptrQeomp"x)#srcxdstx}x)y#Ry#h)Xmsgh eomh srch3dstiF}i)nk)d."k / 8o 9 E : 0 0K bionic/libc/netbsd/resolvbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetres_comp.c_types.hstdint.htypes.htypes.htypes.hin6.hin.hctype.hunistd.hLHGJJwJuww}FPHI} vw I    GKL?IKL  >L"@$.$.$-$_$E$I$e`O$-!!0@Y$8/I$ &-!0@G-$H_$!`E$`.$$&-K$j-@M$ - `!0@!`!`!<'!*$b.$ E@$ $<'!@C$!(.$^c, @\F8 ` $!(C$^c,@\F8!G,$ $C$@^c,`!$<'! <'! <'! 0<'! <'!' !  '$C #P '$ '<'! <'!'$ 8 !@.$$$ (' |  L ,    dP H XP(H |   $L 4 D, T d t dP H XP(H`VxVVVRR (T(DT T pUxUR$$R T T T U T Ud (T(d 0U(H`P\` T U V WX( 0T 0U 0V 0W0P`8LR,__res_hnok__res_ownok&__res_mailokj__res_dnok_getshort_getlong__putshort7__putlongq__dn_skipname__dn_comp)dn_expandlL,dX |xL,dXdn_expand__dn_skipnameshort intin6_addr_getlongbionic/libc/netbsd/resolv/res_comp.c__uint32_t__uint16_t_tolower_tab_dstsiz__putlong__u32__res_ownok_getshortuint32_t_ctype___putshortfloatlong long intu6_addr32long intu6_addr8_toupper_tab_saveptrin6addr_loopbackunsigned char__be32signed charlong long unsigned intunsigned int__res_dnokuint16_t__res_hnok__page_sizeu_int32_t/u/raghu/ics_feb29u_int16_tcharshort unsigned int__page_shiftdnptrs__u16__u8long unsigned intin6addr_anydoubleescapedu6_addr16__dn_compin6_u__res_mailokGNU C 4.4.3u_charlastdnptr__be16GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__res_hnok.rel.text.__res_ownok.rel.text.__res_mailok.text.__res_dnok.rel.text._getshort.rel.text._getlong.rel.text.__putshort.rel.text.__putlong.rel.text.__dn_skipname.rel.text.__dn_comp.rel.text.dn_expand.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X`5 $X1>Lp^pk,Z $%h1 npj (X1 zT 8 L ( 1  )1 ,4  )1L  4)1d  L)1 |  d)1 d |)15 1 )1IXE )1]phY )1!n@j t*X1#|pwx *`1%p ,-1'pFp 4-`1)p -1+p0>c0o 2 #    !#%')+-./& 1L=FS,^hs|dXbionic/libc/netbsd/resolv/res_comp.c__res_hnok__res_ownok_gp_disp__res_mailok__res_dnok_getshort__ns_get16_getlong__ns_get32__putshort__ns_put16__putlong__ns_put32__dn_skipname__ns_name_skip__dn_comp__ns_name_compressdn_expand__ns_name_uncompress  @"`#$&(*, .@0 !%3:AHMZ_lsz%0lx    !(3 7 L[elw {    "29AE\ls~+6:>Q`o~X    1 BSdu!! 0 !!x !! %!! '!! )!! +!! -!! /!! 1 $( 48 DH TX dhtx ( 8 H X hx      ! % 4 8 ? C R V ] a p t            "15=AQU\`pt  $37FJQUdh   ( 0 8@HPX`        ( , 0 4 8 < @ D H L PTX\`dhlptx|res_data.o/ 1331265336 1002 1002 100644 23388 ` ELFL4P4(?<?( H@8@P0% RU$ > $ > : ; I $ >  I : ;  : ; I8 I !I/  : ;  : ; I : ; ( &I : ; I8 ' II : ; !I/ : ; &I : ; <  : ; I : ; I 8 .: ; I .? : ; ' @ : ; I .? : ;' I@  : ;I !.? : ;' I@": ;I#.? : ;' @ $.? : ; ' I@ %: ; I&.? : ; ' I@'4: ; I(: ;I)1RUX Y*: ; I+1RUX Y ,: ; I -.? : ; ' @.4: ; I /4: ; I? < 0!14: ; I?  int2W40`ri3L5^) wB>WN0$<Ct>uWv0w~Vyy!Ws $?# %s#  + - - .#  , ?# 8 W#  #  # >      g -  = -  =  M  h  #'^ >a T  G U# x V #  W)#  X)#  Y #P dT  e#  f # q g)#  h# J  N W X#  Y)#dT w_p x#_r y)#_w z)#  {E# T |E#_bf }e# w ~)#  # ; #  #$  #( % +#, Z e#0_up #8_ur )#< 1#@  A#C_lb e#D X )#L y Z#P)))ZZ))  )& >A  >Q ~ \!  E #  # = #  !#B  1#B  )#B   #B P #B  #B  #  " ! 41 Qj^A/ k7mtz^)T)$q^))J. # #o # o# #ext#   ) i 0pad Z.  /P\#+ )# )# )# )#  #id#@  #D / #` M)#0#0# 7? # O # li# # E)# T)# # #_u# _ #   /  ? O  _ \o V) iT T8  8 T!2)LJ "a2) "b2>"c2)\"d2)z##$3) %inp  &^) 'rv_)!m!)O (! (" (#)>(Q#)g $ %))o ,'!) ( ()(Q)(, ))o ,(&\)U6 %bufu*)%ans*4)+o (P&) * :*)c*Q)*к)+o ,p&!)[ %op)* (*)Q*Q)zH),buf) +o ,-1 %msg%len)*Q1+o $ %msgI*Q1\>%msgo..,M./,/8 /V9kqE/_:k Q0/ /r0/\0  1C2/O1 bionic/libc/netbsd/resolvbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetres_data.c_types.hstdint.hposix_types.htypes.htypes.htypes.hsocket.hin.hin6.hnetdb.hstdio.hresolv_static.hresolv_private.hresolv.hin.hctype.hunistd.harpa_nameser.hKKt  K )tKvE ~,J~JJ~J,~t=~,J~JJ~J$~t=$~JJ~J~ttFN,JJJJ$~t=,JJJJDt=JJJt<'!D<'!D!<'!'$!@!!!(!0` !8@$('<'! <'!!( <'!'C`$DE$ǬI(1 <5K@B@ @$  '<'!'D@<840 !!b0@! ($ !@D(X\!0@!(` !8 D@<840H' ( @( T$<'!'<840,(!!b0@!  $!@D P!0@!(` !8 <840,(@'  @  T$<'!'40,(!!b0@!  $E !(@!0  !840,(8'  @  $E 4$0,(8'<'!'<840,(!!b0@!  $!@D P!0@!(` !8 <840,(@'  @  T$<'!'LHD@<8(!!b0"@! 0$(!@"D0lp`hd $!(`!0@ !8 LHD@<8P' 0(@0 T$<'!',($!!b0@!8 $E!( !0,($ 0' @ $E,($0'<'!!0 $<'! T$QUERYIQUERYCQUERYMCQUERYUNOTIFYUPDATE678910111213ZONEINITZONEREF (048<@DHLP\ |    LP(D  P D$PHX$P@XP8P$P@X$PPXP0L   |   $ 4DLP(D \ l|P D$PHX$P@XP8P$P@X$,PPXTP0L t L( ,T,@X 4U4@S 8V8@R 8W TU  HTHcc HUHbb HVHaa LW|WW HTHcc HUHbb HVHaa LWxWW8 ,T,bb @U@aa @V@`` DWhpWW HTHcc HUHbb HVHaa LWxWW HTHcc HUHbb HVHaa LWt|WW0 (T(pa|a <U<t`|` <V<@W@HV|W T U T{ __res_send_setqhook __res_send_setrhook __hostalias __res_optJ __res_close_ __res_isourserver res_init __res_querydomainO res_search __res_send6 res_query res_mkquery[ __fp_nquery __fp_query __p_query_res_opcodesL,0<H48,0<H48(,0@,0<H48,0<H48$(|,<Lndotsnscountns_s_nss_proto_nresres_send_rhook__res_isourserverh_addr_ptrstypeu_int32_tlong long unsigned int_lbfsize__u16defdnameres_done__sFGNU C 4.4.3retransres_nextnslong long intsigned char__hostalias_ubuf_base__res_send_setrhooks_aliases_cookielong intdname__res_closeres_modified__be32_res_opcodesservent_blksizehostentuint16_tdouble_offsetin6addr_loopbackhostfoff_t__uint32_tmaskoptionsbionic/libc/netbsd/resolv/res_data.cres_errorin6_uns_s_anres_static_readns_s_arfpos_thoststayopenres_mkquerys_addranssiz_close__u8h_name__u32_file_ext_toupper_tab___res_querydomainres_querynsaddr_listnamedataservent_ptrshort unsigned intsin_addr__padres_send_qhookh_addrtypeshort intanslennsorthost_aliasesu6_addr8answer__res_opt_writesin_familyunused__p_querydatalen__res_state__res_sendu6_addr16s_porth_aliasesu_short__res_send_setqhooku_intretryin6addr_any_padres_need_initfloatns_s_zns_namesa_familyclassh_lengthh_addr_listnstimesaddrnewrr_inunsigned char__ns_sect__fp_nqueryhostbufres_h_errnofile_tolower_tab___sFILEqhook__page_sizeFILEbuflenrhookin6_addrres_initsort_listuint32_t_seekhost_addrlong unsigned intdnsrchchar_sizeunsigned inthook__uint16_trstatic_ctype_u6_addr32ns_s_max__kernel_off_tsin_portres_goaheadpfcode_vcsock__page_shift__res_state_extsa_family_tsockaddrsockaddr_inns_s_qd_flags/u/raghu/ics_feb29ns_s_uddomainnssocks__fp_query_nbufns_s_prsa_datau_charu_long__sbufres_sendhookactres_search__be16in_addrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__res_send_setqhook.rel.text.__res_send_setrhook.text.__hostalias.rel.text.__res_opt.rel.text.__res_close.rel.text.__res_isourserver.rel.text.res_init.rel.text.__res_querydomain.rel.text.res_search.rel.text.__res_send.rel.text.res_query.rel.text.res_mkquery.rel.text.__fp_nquery.rel.text.__fp_query.rel.text.__p_query.rodata.str1.4.rel.data.rel.ro.local._res_opcodes.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 8Lp8^pZ D= np5j LMx= ~z M= 4 M=LTL M = N = 4N = TNP=%l! NH=A\= NH=VDR 4O@=k$g tOH=  { OH=" P@=$ DP=& \P =(2dt@ |P=+p P=-D! Qx=/&p"" dR =15pV(#1 X=3Ipy)E X=5\p *`X YP=7jp0i+3u01~o11$>P>% tB    "$&(*+-/13579:;& :CI]iLs~&1?JV `m"y$&(@+bionic/libc/netbsd/resolv/res_data.c__res_send_setqhook_gp_disp_nres__res_send_setrhook__hostalias__res_opt__res_nopt__res_close__res_nclose__res_isourserver__res_ourserver_pres_init__res_randomid__res_vinit__res_querydomain__res_nquerydomainres_get_dns_changed__get_h_errnores_search__res_nsearch__res_send__res_nsendres_query__res_nqueryres_mkquery__res_nmkquery__fp_nquery__res_pquery__fp_query__p_query__sF_res_opcodes% (@)`*,.037 9@;`=?AB    !%3 : A H M Z _ l s z                 * 5 @ K W e           N Z i u {               * 8 F [ f r         $ 2 @ j x   R ] j x        @ F L R X _ j     7 E S         + 9 G V h z         p  }                   ) 7 E L  T  X  a  l p                    !  0  C G Q  ] a e n  y ~                    " + / 8  C G K T  ^ c  m r  |                      "  >  P T ]  d h l                  - 6 R _ w     D    ! 6 GYxI'&& '&& '&&$ +( '&& - '&& / '&& '4 'P 'd 'h 1x ' ' 2&&, 'H 0p 4t ' 5 0 6&&, 'H 0l 8p ' 5 0 6&&( '@ 0\ :` ' 5 0&&, 'H 0l <p ' 5 0 6&&, 'H 0 > ' 5 0 6&&$ '< 0X '\ @| 5 0&& ?&& C A  $(,048< $( 48 DH \` lp|,0TXtx ( 8 H ` p0Xx     $ + / > B I M \ ` g k z ~  $+/>BIMTXgkrv},07;BFUYaeuy %):>EIPTcgnry} (,37>BQU\`gkz~ $+/6:IM\`os   ( 0 8@HPX`hpx (,048<@DPTX\`dptx|            $(,048<@DHLPTres_debug.o/ 1331265336 1002 1002 100644 73524 ` ELF(P4(li8 ((00 PX((8888@% RU$ > : ; I$ >  I!I/ $ >  I  : ;  : ; I8  : ;  : ; I : ; (  : ; I8 &I : ; !I/ : ;' II : ; &I : ; <  : ; I : ; I 8  : ;  : ; .? : ; ' I  : ; I!.: ;' I@ ": ;I#4: ;I$4: ;I%4: ;I&: ;I '4: ;I ( : ;)1X Y*1+.? : ;' I@,4: ;I -.? : ;' I@ .4: ;I/1RUX Y0 U11X Y2: ;I 3: ;I4.: ;' I 5: ;I61RUX Y7.: ; ' @8: ; I94: ; I:4: ; I;4: ; I<4: ; I=4: ; I > : ; ? @1X Y A.? : ; ' @B: ; IC4: ; I D: ;IE UF41G41H41 I4: ; I J4: ; I? < K4: ;I? < L4: ;I?  M!!s  int&;0T) *2mT3)4; -g1I 3bw4t 5R 3 Tm}; # . C dq tT um v;m w yY zC { !m   : $# } %# 0  - ..# K V # m m# # V#Tf      9D l    f# L . ) m#  9#  D#  #  !.#&^k  J  g. 0n  o# ho#_idp# E p# p # Eq# ? rk#$ " s)#( !t#, e, uv  # Q# #ttl# # #I7   4L E =  <D9 O %:.   7  -  ?  ]   { # W  T T }  wu    g    6y     ' KI !a"@#$%&'g()*  %   u=I5    0 Rw Y ]  T 6U# ?V# W)# X)# Y#  d e# f# g)# h#  NO WO X# DY)# Twq _px#_ry)#_wz)# E {[# |[#_bf}&# P ~)# #  # Y #$ \  #( p #, 1&#0_up#8_ur)#< ,  #@  #C_lb&#D )#L #P)  q ) )   )  )  )    T T B OR\!  #  # y # u #B  #B m)#B  #B #B w#B # "    j )b 4 k m5 ;  d d o u { )u j   ) eLq    ){ )u    u 8 v)# w # zx #& # >#g # g # w #ext #w )   0 pad 1&  /=\#+ A)# )# # )# #idp#@ 2 #D '#` < #;#^ ;# 7# o G# G * #  # )# !)# E {# 7 {#_u # #W#'7G W  gar  j sin    ˶tm,-W .)# /)# D0)# k 1)# 2)# L3)# 4)# 5)# +6)# 8#$ d 9 #(&)s c)!) p"#;#;1$s%cp e# )$ )  !S &T"?u 'cp S#s%deg)*%min)#)#l))(l ,)WX`*i+]W"W,Y,#ZZ(#['' +xb $n" b,cn~'+5 #"C"8 )V"_u ,  +  _""8 )"_u %,-T  "q)Y-X> H" >)w">)#?+9P <"kP)#_Q)%#R P,lS+c , n"Q,)#_-)#. ,C/+ :)" : %i;)T.len;)#;)g+])"1^ " _{ %cpa #a .bcpb{ #M dE# dn%altd# e# e#f) #!f)% # f)d %hpg %vph %sizi ,j)L,j)P(@/WQ*i0s.t_l${ 00.t_l${ 0H.t_l${ 1W*i)W48*i+  C2ux3buf) " 0a 'retC@S-+d " ,n+ ) " "  A "_u + ^3buf "u  #1 #vO #_)y (L p+Ol 3bufl "lu #m" #vn@ #_o)j (L |p+1 P a3cpQ 3msgQ "R)" S"T)O%nV)$V)+d g|3cpg3msgg"[g , hw%ni54 )5_c)5_p +:^3cp:3msg:3len:)"[: , ;w%n<)6pA**- H3cpHb3msgHu"[H 7t8+8M 8 kd8 )8[ 9n):9 )0: )d:);buf<:=rrw>?9ttlˑ@**g ,AC  78+XBmsgBlen)8[ CM ,: ):):)C:)w<{ LQ . L i .  ~ Ldw n  1L   L    MJ    bionic/libc/netbsd/resolvbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetres_debug.cctype.hstdio.hstddef.h_types.hstdint.hposix_types.htypes.htypes.htypes.hsocket.hin.hin6.harpa_nameser.hnetdb.hresolv_static.hresolv_private.hresolv.htime.hin.h L;, Js GzJ JitKuKIK <zJ wJ JLpO;{t=I{Jv-tJJ,} Jb<#Jus,W)JzJJyJJLHLIwtKIIJMEKLz JIKY0yJJHL<IwItI)uIKIKIKvt'yJJtIwIt $? =prv$IJuQIK9KK $EOEOLv>Kt$EOEOLv>Kt((CIKztwJ Jq$N(FN8NvIK=t@t=zJP <vJ KnhJoJ KIJJJ HSJ/@X0(=>ml0=s$W~t<^<<}Od dvJKKKKPDdhhhhhhh <$0t440,<~?<f0r$$$ $$$$$v<JxJLP}M}LE}MGMLKzJMEPwJPGtJLQGPIKP>HLFN8LFNFLP}}J}JJ}J}LH}JJ}J}J<}JzJP}JPzJFNF}JJ}JJ}JJ}JJ}JJ~LN}JJxJ}JJRF}JJxJ}J}HHLN}J<}J}T}JD}X}JDv  hI4IKMXh4> <'!bF0$ ,.$!(h@`!Xc$!PbbI0(% -E%!px!(.$F!!(E'! $!ȌG$+Ȩ# $ $ $X j) (j!%b0c$f0% ,@!c$g`0%@h!P i-  B%$!Oc$8(%!0Ȍ $X j) (j!%b0<'!f0I$ '-!@@X!Hbc$!@&f0I$ *-@%!p͑1 c$b!83c$c$fI$ )-, 0!h!P$03x-!03,D@j!xe1c$c$x!H-1c$n!`(3c$c$X %!pK̍!Ȝ J$ I- !H @h !`c$!PfI%0J$ K-`!1 c$b!Xy&3c$c$fJ$ J-2@!h$('!H-!0 $x#X#pia##x HA# !pO <#hmP!a#!H8 @ #xH!pY#`n!P>HEADER<<- opcode: %s, status: %s, id: %d ; flags: qr aa tc rd ra ?? ad cd; %s: %d, %s: %d; error: unknown LOC RR version-%lu.%.2lu%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %s%d.%.2dm %sm %sm %smINCHCHAOSHSHESIODANYNONERSARSA KEY with MD5 hashDHDiffie HellmanDSADigital Signature AlgorithmEXPIREONLYNo algorithmPRIVATEAlgorithm obtained from OIDPKIXPKIX (X.509v3) CertificateSPKISPKI certificatePGPPGP certificateURLURL PrivateOIDOID PrivateAaddressNSname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTtextRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressRTrouterNSAPnsap addressNSAP_PTRSIGsignatureKEYkeyPXmapping informationGPOSgeographical position (withdrawn)AAAAIPv6 addressLOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)TKEYtkeyTSIGtransaction signatureIXFRincremental zone transferAXFRzone transferZXFRcompressed zone transferMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)NAPTRURN Naming AuthorityKXKey ExchangeCERTCertificateA6IPv6 AddressDNAMESINKKitchen Sink (experimental)OPTEDNS Options"any"NOERRORno errorFORMERRformat errorSERVFAILserver failedNXDOMAINno such domain nameNOTIMPnot implementedREFUSEDrefusedYXDOMAINdomain name existsYXRRSETrrset existsNXRRSETrrset doesn't existNOTAUTHnot authoritativeNOTZONENot in zoneBADSIGbad signatureBADKEYbad keyBADTIMEbad time?ZONEPREREQUISITEUPDATEADDITIONALQUERYANSWERAUTHORITY<'!'40 ( ('FG Hl$$FGD CB& $4&08'<'!'$O,`$<<Y4+B)$@! `!(@!0 !8 @8!  !(8 $ !(8& F$D8 ! <*8&!8$ $|xtplh'& ! 8Z@!@HJD!  '8w&`02r@& $'ߣ 8D 8! & !0@p8!(  $k8<'!`'|x8@'!! !(!0@ !@8PTX\`dhl$@DHL0 $( ,8lPTX\`dh $@DHL,0 $( !@`#8HLNP`Rd0Q!(! @ p8$p!8@ ! `#A`8j/@;$ !(8`#`x0d0'$$ !88PTX\`dhl@DHL $(, 0@8PTX\`dhl $@DHL0 $( ,{@8PTX\`dhl$@DHL0 $( ,X@8PTX\`dhl$@DHL0 $( ,k@8PTX\`dhl $@DHL0 $( ,H@8PTX\`dhl$@DHL0 $( ,%@8PTX\`dhl$@DHL0 $( ,@8PTX\`dhl $@DHL0 $( ,@8`#a`d0^ s0 `提O$ $'! %!(@!0$!Ƞ ! !(@$ $!Ƞ ! !(@$@$!Ƞ ! !(@$$!Ƞ  8  Q !(  $|x' %P@;$O$U@x0i0 j@ ! !(`8!0@%!8 ! 8$ !(`8!0@!8!  &8$ !(`8!0@!8!  &8!(` $8&!0@!  !8`#p`8r $ !(v8*hN{;$ 8D 8! $ !0@|x'$$$ !858$$$ !8v8$$$ !88$$$ !8~8$$$ !88$$$ !88$$$ !88$$$ !88& $'ɣ-(<'!P'H!r@ $ $$ g j%6xl %x-%(f%R <%%%x6%pt<%+`!p!02:P#xO':\N$Tb __p_key_symsV __p_cert_syms~ __p_class_syms __p_type_syms __p_rcode_symsp$ H|t LXXddptxpPTpx\d8X 4|txLT0@, 8X 4|txLT0@, hhlplpp$ H|t ns_r_badsigns_sectdefaultsns_t_keysize_tns_r_formerrsa_familytm_hoursockaddr_in6_readsuccessns_t_wks_writeint32_tns_t_ixfrsin_family__ns_msgsin_addrin6addr_loopbackns_t_srvhpval__u16cert_t_pkixns_t_nimlocns_o_max_nbuftime_tns_t_minfo__u8sin6_addrtm_wdaytmpbufrstaticstatpasciins_opcoderetranslongvaltyperetbufcert_t_url_eomstayopenendptr__u32countns_t_invalid__p_sockun__uint8_tmsglen_fileresultsecssuccesspmvallongsecfracrdatas_namens_t_dnamelong ints_portdo_sectionsymbolsns_t_nullmyclocktm_isdstns_f_aans_f_ad_sizens_s_ns__kernel_off_tres_stateclassu_char__p_optionns_r_nxdomainns_c_chaosns_t_opterrorns_t_aaaalatmintm_ydaysigned charns_t_a6uint8_tlatsecfracnamelenh_addr_ptrsns_f_opcodens_s_prwhich1which2_vcsockunsigned charsizevalh_aliasesns_t_nxtres_static__p_secstodatesecsfrac__ns_classns_s_qdsizestrlatdegsin6_scope_id__p_key_symsvaluens_o_notifynbufcharns_r_badkeysin6serventoutputndotsns_t_zxfrunused_closens_t_maxnsaddr_list_msg_ptr__uint16_t__sym_ntopns_t_naptrsockaddr_inns_r_badvers__p_timesin_port__p_update_section_symsreferencealtns_t_cnameh_addr_listtm_mincmvalaltmeters__loc_atonhpstrns_t_anynewlensin6_port__p_default_section_symsns_o_statusns_r_notauthisspacens_o_query__p_classu_int8_tres_send_rhookfilein6addr_anyclassbufhost_addrns_t_apl_cookie__res_nametotyperdlengtharcounthostenteastwestmaxcp_counts__ns_cert_typesunnamenstimestm_secns_s_ud_offsetns_t_nsapdefdnamens_t_hinfo__ns_opcode_exth_name__res_statens_rr__res_nametoclassns_t_atmaprecsize_ntoahostbuflong unsigned intres_goaheadmytimerr_class_tolower_tab_servent_ptr__sFILEretryh_lengtht_cps_protons_t_a_res_opcodesns_s_maxoption__res_state_extaltfracres_modifiedns_t_txtwhich_sectionsns_f_max__p_section__p_class_symsretvalhumannamens_r_noerror__p_type_syms__isthreadedh_addrtyperes_h_errnos_aliasesGNU C 4.4.3res_send_qhook__uint32_tsymslong long inttm_monqdcountns_t_ptrstrptr_ctype_doubleres_errormasktypebufns_t_locpoweroftenlongminfloatu_longlatsecns_r_notzonens_t_nsap_ptrns_s_znaddropcode__kernel_time_tcleanupversionvalunsigned inthostfns_t_kxbuflenns_t_certancountu_intu6_addr16__align32longdegns_r_max_ubufdnsrchsflag_sect_flagsdonelongsecu_int16_t__p_typein6_addrns_t_mbns_t_mdns_f_zns_t_mfns_t_mgoff_tns_r_notimpltempllltemp1lltemp2ns_t_mr__p_cdnamens_t_mxcert_t_spki__ns_rr__be16__padns_o_iqueryu6_addr32__dn_count_labelssin6_familyns_c_invalidFILEqhookhandlens_t_ns_seekres_donetm_mdaybionic/libc/netbsd/resolv/res_debug.cns_t_tsigns_msgbinarysizens_f_qrlong long unsigned int__ns_rcodesa_family_t__ns_flagns_r_servfail/u/raghu/ics_feb29uint16_t__be32ns_t_gpos__p_fqnnamens_f_rans_f_rdlatitlatlon2ulns_r_yxrrsetres_sockaddr_unionsa_data__space_blksize_basecert_t_oidns_s_anns_s_arns_t_pxexponent__sym_ntosres_symsockaddrpflagns_t_signssocksres_sendhookactlatvalaltsignns_t_mailans_t_mailbin_addrnumberns_r_refusedns_f_tc__p_rcodensort__p_fqnamesort_listns_t_rplongitns_t_rtmantissahostnametm_gmtoff__sym_stonns_r_yxdomainshort intu_int32_tvpstr__p_cert_symsns_o_updaterhook__sputc_msgsectionns_r_nxrrset_rrnumprecsize_aton_padpfcode__res_pquery_lbfsizecert_t_pgptm_zonefndhemi__loc_ntoarrnumns_c_hs__sbuf__ns_typefpos_ts_addr__p_rcode_symsns_t_afsdbuint32_tu6_addr8ns_c_inns_c_maxns_r_badtimens_c_none_toupper_tab_ns_t_x25ns_t_eidin6_u__ns_sectns_c_anyns_f_rcodens_f_cdtm_yearshort unsigned intns_t_sinkrcodens_t_soa__p_cdnnamens_t_tkeyvpvalres_nextnsu_shortnscount__int32_tnorthsouthoptionsns_t_isdnlatlonstrptrsin6_flowinfoprecaltvalns_c_2ns_t_axfrhost_aliasesGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.precsize_aton.rel.text.latlon2ul.rel.rodata.latlon2ul.rodata.str1.4.rel.text.__p_secstodate.rel.text.__p_option.rel.text.__sym_ntop.rel.text.__sym_ntos.rel.text.__p_rcode.rel.text.__p_section.rel.text.__p_class.rel.text.__p_type.rel.text.__dn_count_labels.rel.text.__loc_aton.rel.text.__p_sockun.rel.text.__p_time.rel.text.__sym_ston.rel.text.__res_nametotype.rel.text.__res_nametoclass.rel.text.__p_fqnname.rel.text.__p_fqname.rel.text.__p_cdnname.rel.text.__p_cdname.rel.text.do_section.rel.text.__res_pquery.rel.text.__loc_ntoa.rel.data.rel.ro.local.__p_class_syms.rel.data.rel.ro.local.__p_key_syms.rel.data.rel.ro.local.__p_cert_syms.rel.data.rel.ro.local.__p_type_syms.rel.data.rel.ro.local.__p_rcode_syms.bss.output.5209.bss.tmpbuf.5053.rel.data.rel.ro.local.error.5052.rodata.poweroften.bss.retbuf.4754.bss.nbuf.4723.bss.nbuf.4698.bss.classbuf.4686.rel.data.rel.ro.local.__p_update_section_syms.rel.data.rel.ro.local.__p_default_section_syms.bss.typebuf.4662.bss.unname.4644.bss.unname.4626.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 |j>XLpX$^p|!Z <j np( j j ~4pz 0j 5 8j9 0j2;D E HjXF$ dj|H Hj4I THj'I # j; JH7 @jQTJM `j eJa \`j"xKt j$0L Hj& Q 8j(Q TXj*dR j,S Pj.,T Pj0@U d8j23,V|/ j4HVD 8j6^WZ j8sWto pj:T\  |j<e Pj>l` T8j@$mH PjBlmH PjD#mX ,jFH pD <jHjp{pXp ,jLp(p p(p(pp< 4 jS64q<2 T jUbpqtpqpqppq tjZt j\pw  j^p Tj`po \jbpGx $jdp0#0o! k    'p 5(N@JJV(Q`XlYx<U<S R"W$&(*(P,.02468:t:<> OLWK@BDFHJKLNOPQRSUWXYZ\^`bdf l<#)/\4D9t?DJ$OU|[T`,ekdpv|  (pL`,DP@$,( <840$|*06\gh<EM\ck$v HH `@"XF$&("*+;,FQ.bnv~02|468 #17> <KZg>ryHBHDbionic/libc/netbsd/resolv/res_debug.cprecsize_atonpoweroftenlatlon2uloutput.5209nbuf.4698unname.4644unname.4626__p_default_section_syms__p_update_section_symsclassbuf.4686typebuf.4662nbuf.4723do_sectionretbuf.4754error.5052tmpbuf.5053$LC16$LC52$LC0$LC19$LC9$LC14$LC4$LC18$LC12$LC7$LC5$LC10$LC1$LC20$LC2$LC17$LC11$LC6$LC3$LC13$LC8$LC15$LC21$LC22$LC23$LC24$LC25$LC26$LC27$LC28$LC29$LC30$LC34$LC32$LC33$LC31$LC35$LC36$LC38$LC39$LC48$LC49$LC37$LC47$LC40$LC42$LC41$LC46$LC45$LC44$LC43$LC51$LC53$LC54$LC50_gp_disp_ctype___p_secstodategmtimesprintf__p_option__sym_ntop__sym_ntos__p_rcode__p_rcode_syms__p_section__p_class__p_class_syms__p_type__p_type_syms__dn_count_labelsstrlen__loc_aton__p_sockunstrncpyinet_ntop__p_time__ns_format_ttl__sym_stonstrcasecmp__res_nametotypestrncasecmp__errnostrtoul__res_nametoclass__p_fqnnamedn_expand__p_fqnamefputs__p_cdnname__isthreadedputc__swbuf__p_cdnamemalloc__ns_msg_getflag__ns_parserrfprintfstrerrorfree__ns_sprintrrfputcfwrite__res_pquery__ns_initparse_res_opcodes__loc_ntoastrdup__p_key_syms__p_cert_syms  @` @` @`, KKK!J%1K>KEKJKWK^KcKpKuKKKKKKKKKKKKKKKK$K/K:KEKPK[KfKqK|KKKKKKKKKKKKK,K:KHKoKzKKKKKKKKK K/K;KAKGKMKSKYK_KeKlKwKKKKKKKKK-K8KEKSKbKKKKKKKKKKKKKKKK KKK"K(K.K4K;KFKRKXK^KdKjKpKvK|KKKKKKKKKKKKKKKKKKKKKK KKKK%K+K1K7K=KCKIKOKUK[KaKgKmKsKyKKKKKKKKKKKKKKKKKKKKKKKKK!K'K-K3K:KAKJKWK]KcKiKpKxKKKKKKKKKKKK'K3KAKPKKKKKKKKK K+ K9 KU Kc K K K+ K9 KH KW Kf Ku K K K K K K K K K K+ K K K K K K K K K/ K= KK K K K K K K K K K# K1 K? KN K` Kr K K K K K K K K KhKyKKKKKKKKKKKK-K;KIKYKtK  KGKGKGKGKGKK   K(K3GEKPG`GpGuKGKGK   KGKGK8KKG/K;?CGLKWG\Ki>KGKGKGKGKCKK GK(G-K8G=KHGMKZDaKmq}KGKKGKGKGKGKG KGK%G*K7?>KJNRG[KfGkKvG{KGKBK  GKGGKGK!! GK G%K0G?GDKOG`KkGpK{GGKGKGKGKGKGGG GKK,K3!<!@JRJgKtJKJK!!!!K""GG$K/GUKa#e#iGrK}GK=K%%GKGKGKGK&&G GKG"K-G2K=GBKMGRKY&`Kl'p'tGGKGKGKGKGK'K((GGGK"G'K2G7KBGPGUKcKo)s)wGGGKGKGKK** GG/G?GDKOGTKmGv*zJK++GGKGK,,GKGK GKG K*G/K9GGKQGVK`GeKoG~GKK,,,,,K..GK GG'G,K6G;KJKTGYKcGhKrGwKGKK...J..KKK6KBK`Kl/p/tG}KGKGK:K9GKKGKGKG KK#G(K3G8KCGHKTK`KpK|KGKKGKGKGKGKGKGKKGK#G(K3G8KCGHJQK^/b/kK|/JJG</JJG</J JG'<IKeKnKKAK@K;KK K! K? KM W Ke  K  K  K  K  ( 'E y!"#4%e&'()*b+s,B .i /x ;;0 ;8;X <        $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |        l p8d N|N\ 88p OxO PP QQ R$R( S,S TDTH UPUT V\V` WhWl LtLx XX  YY > > > > > >l >> >> ZZ [[ \\ ]] ^^ __  `` a a x b4 bbC| CC | bb4 DDx DD    A A4 0 @8@ ( P cTct p dxd|?l ?? ( P eTet p fxf|Bl BB < ` h     L H gTgp $ (=D=\ d=X hlh =t=P $ , T P iXi $ , T P jXj 0 X kkk$ P ( h t  ` , 8 k@kD ` x t ll      mm h d ntn     (  o$ o,op   pp    ( @ < qDqp < X h   rr    s ss    T  $   \ h  ,,$ 0       tt  (u4 H Xud  utux         v vL H wPwp l xtx  yy  zz  {{  | |$ }( }H D ~L ~   ;;  ,0<X d< < <t <  <<  Pp    MM  99 :: :: ::(4@L (,48 (,48 (,48@DLPX\dhpt| $(04<@HLTX`dlpx|  $,08<DH (,48@DLPX\dhpt|((E $E( 4E8PETlEpEEEEE E (E,!\E`"|E#E%E&E'E( E$)DEH*hEl+xE|,E.E/ ( 8Tp ,!`"#%&'($)H*l+|,./     " 1 5 < @ G K R V e i p t                           * . 5 9 @ D K O V Z a e l p                             ) - 4 8 ? C J N U Y ` d k o v z  #'/3CGVZaelpw{ %)04;?FJY]dhw{ %)15<@PT[_nrz~     $ + / 6 : A E T X g k r v !!!!!!!!!!!!!!!!!!!!!!!!&!*!2!6!>!B!J!N!V!Z!b!f!n!r!!!!!!!!!!!!!!!!!!!!!!!!!! !!!! !'!+!2!6!E!I!P!T![!_!n!r!y!}!!!!!!!!!!!!!!!!!!!! ! ! !% !) !0 !4 !; !? !F !J !Q !U !d !h !o !s !z !~ ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! " " " ") "- "6 ": "A "E "N "R "a "e "n "r "y "} " " " # # # # # # # # # # % % % % % % % % % %# %' %. %2 %A %E %L %P %W %[ %b %f %m %q % % % % % % % % % % % & & & & & & & & & & & & & & &" &1 &5 &< &@ &O &S &Z &^ &f &j &y &} & & & & & & & ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' '" '& '- '1 '@ 'D 'K 'O 'W '[ 'j 'n 'v 'z ' ' ' ' ' ( ( ( ( ( ( ( ( ( ( ( ( ( (( (((&(*(1(5(<(@(O(S([(_(f(j(r(v(}(((((((((((())))))))))")&)5)9)@)D)K)O)^*b*j*n********************* ****#*'*.*2*9*=*D*H*O*S*b+f+u+y+++,,,,,,,,,,,,,,,,, ,,,%,),0,4,;,?,F,J,Q,U,d,h,o,s,z,~,,,,,,,,,,,,,,,,,,,,,, ,,,,!,0,4,;,?,F,J,Q,U,d,h,o,s,z,~,,,,,,,,,,,,,,,,,,,,,,,,,,,$,(,7.;.C.G.X.\.c.g.n.r.y.}.................... ...%.).0.4.C.G.N.R.Y.].d.h.w.{.......////////////// ////!/%/,/0/7/;/J/N/U/Y/`/d/s/w/~/////////////////////// ////!/(/,/3/7/F/J/Q/U/\/`/g/k/r/v/////////////////////////!/%/,/0/?/C/J/N/]/a/h/l/{//////////////////// / ////#/*/./5/9/H/L/S/W/^/b/i/m/t/x///////////////////// //  (08@HPX` h!p"x#%&'()*+,./!!! !!! !$!0!4!8!<!H!L!P!T!X!\!`!d!p*t*x*|*....///////////////////////// ///// /$/(/,/0/4/8/</@/D/H/L/P/T/X/\/`/d/h/l/p/t/x/|////////////////////////////////// ///// /$/(/,/0/4/8/</@/D/P/T/X/\/h/l/p/t/////////      ! !""## %$%(&,&0'4'8(<(@)D)H*L*P+T+X,\,`.d.h/l/res_init.o/ 1331265336 1002 1002 100644 30052 ` ELFHP4(520( ( % RU$ > : ; I$ >  I!I/ $ >  I  : ;  : ; I8  : ;  : ; I : ; ( &I : ; I8 ' II<  : ; !I/ : ; &I : ;  : ; I : ; I 8  : ; .: ; ' I : ; I4: ; I 4: ; I!.: ;' ": ;I#4: ;I$ : ;%.? : ;' I@ &: ;I ': ;I (4: ;I )4: ;I*4: ;I+.? : ;' @,: ;I-4: ;I.: ;I/.? : ;' I@0.: ;I 1 2.? : ; ' I@3: ; I44: ; I54: ; I 64: ; I74: ; I 81RUX Y9 U:41 ; U<4: ;I =1X Y>1? @41A1RUX YB41C 1D.? : ; ' I@ E.? : ;I@F1X YG4: ; I H4: ; II4: ; I? < XNint*;N?n2b3)I4;*C3W;4i5t ")3C4 Ib;/#.CCHcdtI~ubv;wyzk !b    $#  %#  G)  5 f p#  e#  -P  ..#   " #  b# l 5#  #I     m   9D   ' # } m  b#  9# [ D#  # ( !.#X^'a" { INO W VX# HY)# Tw_px#_ry)#_wz)# {P# !|P#_bf}# ~)# l# !# A#$ a#( #, i#0_up#8_ur)#< K#@ #C_lb#D )#L #P)! )A) 'a) G))  gII T U# ~V# W)# X)# Y#  d[ e# bf# wg)# 1h# H q r)# s)# t)# $u)# v# w# jx# y#  [ $ \! Q# # b# #B =#B )#B M#B #B #B#" jgikm  <<GMS)M B  ) {9qd j)S)M  65# T# #  #  #extq # )( [hq  #  # 9 #  # ( 0 pad i /Z\#+ )# )# Y# )# A #id#@ < #D  #` #;#\;# - # + # # Y# r)# )# # #_uw # y; #P   + ;  K V  Y sinP   ˫  ina 5   $ af )# 6 # T #\    ?)V K uV cp ppf [!Q "QK "YQ"4Q#cpS#iT)#extUq $~%D, &K T%, &K T%<) &<K T'set< U'cnt<)V(i=)S)Q>0*0? \ +; ,K >-ns)\+so?,K .set?.cnt)-i)*))Q 0 EY\ +d%y,K E/\c(now p0j)1)upV 2-) 3K 3) fp4cp4pp4n):5bufw6))6)\) net6)5uu7HZ 6.)+) V 8t@9:t;0\<Dt+ ?:6 t@A @K )Af XH> >t 9B @ h@ C > \ 0Dr)@3K TEx)g*tz)F||9:G.G/7/t 7u)H] /& I8I9) /PI:)I;I7; bionic/libc/netbsd/resolv/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetres_init.cstddef.h_types.hstdint.hposix_types.htypes.htypes.htypes.hsocket.hsocket.htime.hin.hin6.hstdio.hnetdb.hsystem_properties.hresolv_static.hresolv_private.hres_private.hresolv.hin.h ctype.hunistd.harpa_nameser.h  IJK`JJJLv4JJ&h4(MIKKLHKGEOMwJKK#^JKMvJ0x0'HLXKILH == <sJ JzJPzJPtfJJyJlJKJjJKJyJLhJJLLKKLu=IIKvJ{J7>{J5JwJKSJ5JMJKJRNNKcJ ($HKK~>KK=$IJ~uLKILJJJIKxExJKKJ;w?FKHOKIKIv~MG  JRxJRJ J J JbJ J J J_J},z}~ t  6<IIK4xwLrjRPFNL ip6.arpaip6.intnet.dnschange%s%d.%dnet.dns%s%d;# %unet.dns.search;; res_init()... default dnsrch list:;; %s ;; ..END..RES_OPTIONS;; res_setoptions("%s", "%s")... envndots:;; ndots=%d timeout:;; timeout=%d attempts:;; attempts=%d debug;; res_setoptions("%s", "%s").. ;; debugno_tld_queryno-tld-queryinet6rotateno-check-namesedns0dnamenibble: nibble2:v6revmode:singleboth<'!@B$B$<'!@(B$B$ /@-$!@!@ $Q!HJ)- c$*xb$f%@$ -@!XLK ONOL NK c$*xb$   <'!',($ !  E$$$CBC`!@!$1&! C*8#&,($ 0'<'!'$ ! 4 &! !8 $(('@$$K$I!$ ! lljj oon n HHYY __X X($  ('! <'!' ! $$d '<'!'$ ' !( &d$&B0 ('<'!' ! D0B`G<'! !( $dN $$`5 $5 $$h$dIH @`@@@@ @!@B! @!( h$BFIHG GFIHC$v$dޮע&O,(dK $$jd_!(! @ $"@'! @!( !0@ !   &@"'$N&d' '!$!$' $ $D'$x!  $%& !  !(Q@!!bPQc$! `%% !(bb7@ $5F $ $' LD5$ H!  !0@ ,B@i ! M ,'!B` s&q+$$& !(:@`P&!(!  $!   $@@DI&\F&!(  $ $ $ $+ `+%CD&@+%@$ G+H& &D+&@+C`&+%<`@D@!'!  $ @!  .$@E$ `D&'`D&`BDDH@DU& @HQ&!!c$.V8b.@!PS&+@3*$  .$D$$1&+H3 &F0 d%h@!@M1W&(&]@!1&s&&$ $H $E& $! F$g$ !  !(@$L! !(  $G@! !(` $V@! !(  $v@! !( $Z@_3@ %@ $ F $ G $ $CD $&@U ^6^!  ' $ $ &I(J dG$$0B0%(dEL1`% 0 &N($X3BE d$! %  $ @! '  $@C<% hD  &D($E0BE $%dJE5dE! $ $8@! $ $S@_@7rB ! @<$$4GF B@B`U$%% !(@%% !(Kj5BJF 4CI $DE '& !  D%y ! 'A ! E% $@L5K! % $@! % $ @C<% eDX@<%pN%%!  $@&E$ ! ?K,? $ PK!0@!( !0'!  $@&' ! ?O,?$ pO!(!0 !`(%!   $@ &$$ ! @C <%(iE$!  $@KLp^p\Z oEENdP4H $W   &!6"!"#%')+-/N S X ]4 b, g< lD qH v |  $ D P `  p x  X          01",9B,Zkx~d\ 2:BNUbjq}bionic/libc/netbsd/resolv/res_init.cdns_change_propdns_last_change_counter$LC0$LC1$LC2$LC5$LC4$LC6$LC7$LC8$LC12$LC15$LC17$LC19$LC21$LC3$LC23$LC16$LC18$LC24$LC25$LC20$LC26$LC27$LC13$LC14$LC22$LC9$LC10$LC11$LC28$LC29$LC30$LC31$LC32$LC33$LC34$LC35$LC36__res_get_nibblesuffix_gp_disp__res_get_nibblesuffix2__res_getservers__res_ncloseclose__res_setservers__res_ndestroyfree__res_randomidgettimeofdaygetpid__res_vinitmemsetmalloc__system_property_readatoi__system_property_findsnprintf__system_property_getstrcspnsprintfgetaddrinfomemcpyfreeaddrinfostrlcpystrchrgethostnamestrcpygetenvstrncmpputsprintfstrncpy__res_ninitres_get_dns_changedH J@K`LNOQTj k !%1>ELSXeju$/:EP[fq| '6BQ]ky '5CQ_nz#1M[iw#1?M\hv />M\kzZ) 6 D S b          # 2 D V e t       L ] t        , 7 g u             (  ,  8 n z               #.3FPX\`it{$1EOT_in!;@Paevz!%1;BMQU^irv~5BO   N qII (II ( II4 Mt MII LII L4 PII R8 SII< Sl U V U ,0H P \ p Nt  W X Y !! L Z "D "X"8 #\#p [ \ $$ ] %%( ^d _ ` [ & && a b c b d b e ' '' (( )) **  ++0 fH ZD ,X,H #\#p [ f f f g -$- X  h ..$ XT hP /`/p fl 0x0 f 11 X h 22 f 3$ 3< f8 4D 4h O Q h 5 5 6 6 h 7 7 6 6( g$ 80 8@ 9D 9H hh gd :p :| _ f ; ; f < < f = =< f8 >@ >` \\ ?h ? i f @ @ \ ? ? i, f( A0 AL fH BT B f C CII TII  ( Y, WH X\ !d!t|  $( 48 DH hl ( 8 H l     " * . > B I M \ ` os{ %)15EIPTcgos "&-18<CGNRY]dhosz~  '+:>EIPT[_fjqu| +/6:AELPW[bfmq )-48?CJNUYhlsw~ $+/6:AETXgksw   ( 08@HPX  $048<@DHLX\`dhlptx|         res_mkquery.o/ 1331265336 1002 1002 100644 16844 ` ELFL)P4($!8% RU$ > $ > : ; I $ >  I : ;  : ; I8 I !I/  : ;  : ; I&I : ; (  : ;  : ; I 8  : ; I 8  : ; I8 ' II : ; !I/ : ; &I<  : ; I.? : ; ' I@: ; I: ; I 4: ; I!4: ; I"4: ; I# U$4: ;I%: ; I &4: ; I '4: ; I(4: ; I )!*4: ; I? <  Xint`C2W|g40&33Ls5^ w>W0yvC.t>uWv0w~)yz!Wz~ l$J# \%~#  $ - w .#m   J#  W# k # 4 # >   (  ( e 8 A H 8  H  X  s  #y &:7 F1   U > q/@S'Hc U B   Q GLc418h t!"#$d%&'K()\*$\Q7* cqid d0#rd u0#tc v0#aa w0 #y x0 #qr y0# {0#cd |0#ad }0# ~0#ra 0# 0# 0#K 0# 0#P q T  U# : V#  W)#  X)#  Y# d | e#  f#  g)#  h# UNWT X# Y)#Twv_px#_ry)#_wz)# {E# (|E#_bf}+# ~)# # # #$ #( #, ^+#0_up#8_ur)#< :#@ #C_lb+#D )#L " #P)v))  ))) >  > T\! # # k# #B #B )#B #B #B |#B  #  "  4 j$ ?Rkm: @ $ i i t z  )z o s)Cq  $  s) )z  zU # #5 K# D5 # E #ext[ # E  )U U 0 pad ^ /\#+ o)# @)# /)# K)#  #id#@ J #D  #` )#t0#}0#  #  # / # . # W)# )# # #_ua # % #       % "5 5@  )| 5 n0)_buf }a)) hp !cp ep "n?#$,L## $,L6qQu)I0u5 jopv)=wx)x)[tys?z)%{sbuf| Ca})y hp !cp !ep !n).&0~ dpp@&~@#8',LW @  (_.bX(/b )*rn bionic/libc/netbsd/resolvbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetres_mkquery.c_types.hstdint.hposix_types.htypes.htypes.htypes.hsocket.hin.hin6.harpa_nameser.harpa_nameser_compat.hnetdb.hstdio.hresolv_static.hresolv_private.hresolv.hin.hhJJlHL>>KKKl<0Q>MGLHKMu  <wJ JwJ J0XH,KKIK vJLLKOwJ JwJ JK>L0k?v>>>wuL[K>>>K;; res_nopt();; res_opt()... ENDS0 DNSSEC;; res_nmkquery(%s, %s, %s, %s) <'!'40,b0$@!#@ )!4$0,8' )$ %&H %&   <$(F0& I0+ 4  $ ! !(& ! 4 d&%b'/2rj%`# 0, l8'D%  4 <'!X'!b0!!!@' *$'@!0(Ō! x!  txt$ !0 *@$  X0zr%h <5I2$@j4 %%<#34$D<%h85$` $ ! $*K &$W#0@$#0($p' 'p! $!(  !8@!"2 !(s2! `& $&@,##0#8 &*~ $2 &  d2 &! &2 &&$c#0! !(!0 $!7 *W@$p! &!8 !( L@!" $ !(! ` &! &! &  & | |P8L0Ph   | |P8L04Ph  |8 0T0P`PXTX`` hUU hVV \[ 8WW 8LaXa`$`\|`8\_ \T lTlaTa lUlbUb lVleV$epe lWlcW<cpcc lltdtHdHppd llnn lltgtgppg l l` ` l$ltft$f$ta$a$XeX|aLaLfatfftxR 4RH\RPh0F __res_nopt __res_nmkquery$|$8  |DP|__res_statens_r_badkeyGNU C 4.4.3ns_t_tsigu_charres_statedatalenns_t_nsapns_t_minfosa_datans_t_certflagsndotssockaddrns_t_kxhostfunsigned intns_r_yxrrsetns_t_maxmask_lbfsize_flags__res_state_extns_t_ans_t_naptr_readres_staticdefdname__ns_opcode_cookiens_r_servfailns_t_mbns_t_mdns_t_anyns_t_mfns_t_mgHEADERres_h_errnons_t_mrhostbufuint32_ts_namefpos_t__res_noptfloatpfcodelong long unsigned intns_r_formerrs_porthostns_t_nsns_o_update_padancountns_t_nsap_ptrns_t_dnamesin_family__uint16_t_offsetns_t_zxfrns_t_locdnameres_send_rhookres_errorns_t_aplu6_addr16retranss_addrlastdnptrsa_family_t__u16ns_r_noerrorns_t_afsdbns_t_a6qdcountns_t_isdn_vcsockns_t_soans_t_txth_addrtypeh_lengthns_t_aaaans_t_pxh_addr_ptrsin6addr_loopbacku_int32_tcharns_t_eidu6_addr32ns_t_sinkns_r_badsigbuflenns_t_nimlocdataopcode/u/raghu/ics_feb29__u32ns_r_notzonetypercode_closeserventns_t_ixfrns_o_statusnsaddr_listlong long inth_namenewrr_in_basesin_portns_t_ptrns_t_rpns_t_rt_filerhook__padh_aliasesnstimesns_t_keyns_t_nullin6addr_anysin_addrns_t_srvnsortin6_u__kernel_off_ts_protons_t_tkeyu6_addr8ns_t_mxstayopenuint16_tns_r_refused_writeres_send_qhookhost_aliasessort_listshort intns_r_badversnssockslong intoptions__ns_rcodens_t_wksnscountns_t_cname_extns_t_gpossockaddr_in__be16host_addrres_donein6_addr_blksizens_r_maxu_shortlong unsigned int__u8h_addr_listns_t_hinfounusedns_t_x25res_modifiedres_sendhookactns_r_notauthclassin_addr__swap16gen_xns_o_maxunsigned charns_t_mailans_t_mailb__uint32_t_res_opcodesarcountservent_ptru_longu_int16_tanslenrstaticns_o_iqueryu_intns_o_notifyns_t_optns_t_axfrres_goaheadaddr__sbuf__be32statpbionic/libc/netbsd/resolv/res_mkquery.cns_r_yxdomainres_nextnsdnsrch__res_nmkquerysigned charsa_familyoff_tshort unsigned intns_t_atmas_aliasesns_t_invalidhostent__sFILE_sizedoublens_r_badtime_nbufdnptrsFILEns_t_signs_r_nxdomainns_r_nxrrset__ns_type_seekqhookns_o_queryns_t_nxt_ubufretryns_r_notimplGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.__res_nopt.rel.text.__res_nmkquery.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 2">Lp^pZ ,2P" npWj |:" z2 Tt| :`" :"pd ; "d ;"p\j ;@"p4 A"p( A"p"p  ,A"p0S)0'2o'(B.p# \1   ) . 30  8|CLW\kxbionic/libc/netbsd/resolv/res_mkquery.c$LC0$LC1$LC2__res_nopt_gp_disp__ns_put16puts__res_nmkquery_res_opcodes__p_class__p_typeprintf__res_randomid__dn_comp__ns_put32memcpy  !%3:AHMZ_lsz *5@KVbpYe #/5;AGMSY_ekqw} %+18?FMT[bi ->O`r} !,8FU0>Zh#0>M\kz     % 0        V u           . @ O ^ m |     6 H S  W  [ d n |                   " + 5 C H R W a f p u              *Gcl 4 X x     \  `  ! "  # $$ <    %  &$ $L d x %   4 8  8      $ + / 6 : A E L P _ c j n }                        # ' 6 : I M U Y j n u y                           ' + 2 6 = A H L [ _ g k r v ~                          $ ( / 3 C G O S Z ^ f j y }                           . 2 9 = D H W [          $ ( , 8 < @ D H L X \ ` d res_query.o/ 1331265336 1002 1002 100644 23272 ` ELF7P4('$`?Hh% RU$ > : ; I$ >  $ >  I : ;  : ; I8 I !I/  : ;  : ; I&I!I/ : ; (  : ;  : ; I 8  : ; I 8  : ; I8 ' II : ;  : ; &I<  : ; I.? : ;' I@ : ;I : ;I .? : ; ' I@!: ; I"4: ; I #4: ; I$4: ; I%4: ; I & : ; ' (4: ; I) *.? : ;' I@+: ;I,4: ;I -4: ;I.4: ;I/4: ;I0 U14: ; I 24: ; I? < Cr int-; 2b4;-_|Axj3WF5i YIbe;]vCtIubv;w{y< !bH ~ N $J#  %~#   - = .#V  D J#  b#  #  # I   ( - (  8  H 8  H  X . s  #y ! "5 -OK( n  }I c3id d;#rd u;#tc v;#aa w; # x; #qr y;#W {;#cd |;#ad };# ~;#ra ;#C ;# ;# ;# ;# 3bT ^U# V# W)# ^X)# gY#Qd Ge# f# g)# 4h# UNW X-# }Y)#Tw8_px-#_ry)#_wz)# b{P# k|P#_bf}# ~)# %# DH# #h#$ O#( =#, #0_up-#8_ur)#< #@ #C_lb#D Y)#L #P)H8)h)N)n)) I  I \!x Kx# # # U#B #B 4)#B #B Q#B />#B  #  "  ? j6km++6<B)<1s)<qSYs)B)<HU {# # # s#  #ext #   ) , 0B padB  R /\#+ )# )# 4# )#  #id#@ q #D s #` 4#);#;#  # < # # qH# )# )# b)# 7)#_u# #  #        R ^ K^ TwUdstVsiz0W )( !K !!wU!X)!d)!6B(!)"buf w#hp $n)%)& '3 (W'lpP (WB'txm (Wk)x|(W  3*p)c +Kp +wq+r0+Xs)+ds)6tBu),w~w-ix.ny)/dy) )L6!K W!wި!X)!d)@!6B!)$cp(8#hp "tmp~w(Q)(\)$ret), %i)%)%)() %)() 0-i)L 1..X1/2829P2|:2;2; bionic/libc/netbsd/resolv/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetres_query.cstddef.h_types.hstdint.hposix_types.htypes.htypes.htypes.hsocket.hin.hin6.harpa_nameser.harpa_nameser_compat.hnetdb.hstdio.hresolv_static.hresolv_private.hresolv.hin.h ctype.hunistd.h<zJzJNuJ?4u >bbJM$I4\4I!c4<$$ JwJU=IFLKG T JtJwqJ 0zJPzJa$!J$c$ƒKlJ u <vJ <wKIK <$0JJIU0QJ5JJJ6JIK0 00c<"vM?u}yH!;; res_query(%s, %d, %d) ;; res_query: mkquery failed;; res_nquery: retry without EDNS0;; res_query: send error;; rcode = (%s), counts = an:%d ns:%d ar:%d ;; res_nquerydomain(%s, %s, %d, %d) %s.%s<'!'\XTPLHD@<8(pt!0!!!0'$ @<&<5$(%0<`!0 $! !( !8(>@!0@ j1@ $`-! !(@ !8 (bA!0@$S@0& e0;c4B0@ $&<5$((%0`$%!(!0 !8(!0@!(@!  $(@!0@1V 4$4R\!XTPLHD@<8`'S0 `4 &(4 4$4U\!XTPLHD@<8`'"<$W #B<\J  j1"@2$:"$F2>  $ $ 4$4H$& 4(4 4$4R3  6(43*%2"%h%`xO2%!(@1 1("$ 44Q 44R$ 4$4Q<'!'D@<840,!b0!!! @X2$!(  !8+ ! !  !@!XUj)8@ '%!0 !8 ! !(\`! @!0 !8`D@<840,H'$ ! E(P$!H0(.$ '!( !( !0!  !!(  $LL$<'!'d`\XTPLHD@ !!!!x | @ $#CB@ !@!!.E8b,!@d$+D@f.8s.d)(1+8` $! !(@!0 !8@ d`\XTPLHD@h'<8O#n0O!D&D3&!40€@.$O! !(@ !8@ D$ "$p_$dE$eF$s&#fo0N$ @!$@<$s<8$s0b4h$d`\XTPLHD@h'#m0!40<!(@!8!  !0@ 8x!! !(@(' $p@ ! !0!8 !(@d`\XTPLHD@h'l` $,8v<0$0!؀}' <$@K < 4!%4!! $7WJ$ $$D$ 85U:$!!40w |  0(Ph  (P\0LPh   |  0$(Ph  (XP\0LPh  ( hTh``(` hUhfpff \f hVhePe\tee(e hWhd(d@xdxd(d hha\a\a  $a$\\a( hhg\g\g  \g\(hlVVR V R@VRVR0V@DV\VRV 4R\lVVV V\S S\lSSSS\pf fp(f\xd dx(d\|c c|(c PTP bb PUPaa PVPX`XtVt` V (V(@`` PWPdd PPccUX`UU`@p`L \T\8aDaTa`La \U\4bD@b\|bPb`bb0Lb \V\(eDpeDe` e0Le \W\ gDhg<g`gLg dDD<d<HdH``d00Ld fDDHfH@f@``fLfSTST SDT$TRTS0RTTTT0LT0cp,c8xccxc0c<`D0`8`X```L`0cDpc$,c8xccLc`xcLcRLRR8`RRR`xRRRR(4RntPn\dnnxn0n8Ln\RRRRR4LR|RRRR\G __res_hostaliasc __res_nquery __res_nquerydomainc __res_nsearch4(Ld0<x(Lnscount__ns_rcode__swap16gen_x__ns_opcodesize_ts_protores_send_rhookh_addr_ptrsrcode__be16typedonens_r_notzoneu_int32_tlong long unsigned int_lbfsize__u16res_doneGNU C 4.4.3retransres_nextnsns_r_noerrorlong long intsigned char_ubuf_basens_o_notifyns_r_maxs_aliases_cookielong intres_modifiedqdcountstatpservent_blksizehostentuint16_tdefdnamedoublenbuf_offsetgot_nodatain6addr_loopbackfpos_tns_o_update__uint16_thostfoff_t__uint32_tmaskns_o_maxsearchedres_error__res_hostaliasin6_ures_static_readndotshoststayopens_addr_closens_r_servfail__u8h_name__u32_filerhookname_toupper_tab_nsaddr_listservent_ptrshort unsigned intsin_addrns_r_badsigtried_as_is__padretryres_send_qhookns_r_badversh_addrtypeshort intanslennsorthost_aliasesu6_addr8answer_writesin_familyns_r_formerrtrailing_dotsaved_herrno__be32ns_r_badkeyu6_addr16__res_stateqhookbionic/libc/netbsd/resolv/res_query.cancountns_r_notauths_porth_aliasesu_shortu_intns_r_nxdomainagainoptionsns_r_notimplns_r_yxrrsetns_o_statusfloats_namesa_familyclassh_lengthh_addr_listnstimesaddr__res_nquerydomainunsigned chargot_servfail_vcsockin6addr_anyhostbufres_h_errnooflagsHEADER_tolower_tab___sFILEres_state__page_sizeroot_on_listFILEns_o_iqueryin6_addr_padsort_listuint32_t_seekhost_addrlong unsigned intdnsrchchar_sizeunsigned int_ext__res_nsearchrstatic_ctype_u6_addr32unused__kernel_off_tsin_portres_goaheadns_r_nxrrsetarcountpfcodens_r_yxdomainns_r_refused__page_shift__res_state_extsa_family_tsockaddrdotssockaddr_in_flagslongname/u/raghu/ics_feb29domainnssocks_nbufns_r_badtimesa_datau_char__res_nqueryns_o_queryu_long__sbufres_sendhookactopcodein_addrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__res_hostalias.rodata.str1.4.rel.text.__res_nquery.rel.text.__res_nquerydomain.rel.text.__res_nsearch.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 B %>Lp^pGZ B8% npj XJ % zt2|`( xJ% pKx%0L K%p|" hL@%0# L %p#   L %pd.` HZ%1p.8- PZ(%Dp.H@ xZp%Rp0D/]0?6foQ6a6v=&! A   !'<,1`6;|@EJ"#O _(luLbionic/libc/netbsd/resolv/res_query.c$LC2$LC0$LC3$LC1$LC4$LC6$LC7$LC5__res_hostalias__res_nquery_gp_disp__res_nmkquery__res_nsend__res_noptputsprintf__get_h_errno__p_rcode__res_nquerydomainstrlensprintfstrncpy__res_nsearch__errno! "@+`/ !%1>ELSXejw~ *5@KVbpYe !'|"4?KYguJXt*-<KZiI 7 S ` n |           / > M \ k        & 4 e p  t  x                    $ . 4  8  A K Q  U  ^ h n  r  w                  + ; F T e p  t  x                 *9>M\kuz -:  O  ## $ % & %@ '< Hp $x (t  | )  )( '$ 4@ ) * ) )$ '  (< ) (  )##\ (X d| , , -  " $` . )##< 0d ) + + + 0T ) + ! " + ) ) ) $( X\   ( \      ! % , 0 7 ; B F U Y ` d k o v z                           ( , 4 8 ? C K O V Z b f m q y }                          # * . 5 9 @ D K O V Z a e l p w {                             $ ( / 3 B F M Q X \ k o v z                        ! 0 4 ; ? F J Q U \ ` g k r v }                        # ' 6 : B F W [ b f m q x |                           " & - 1 @ D K O V Z a e l p w {                           ( , 3 7 ? C J N V Z a e m q                               % ) 8 < C G N R Y ] d h o s                                   ,  0  7  ;  B  F  M  Q  X  \  c  g  n  r  y  }                                 #  '  .  2  9  =  L  P  W  [  b  f  m  q     (        $ ( , 0 4 8 < res_send.o/ 1331265336 1002 1002 100644 53896 ` ELFP4(0-8PXX0?x% RU$ > : ; I$ >  I!I/ $ >  : ;  : ; I8  I  : ;   : ;  : ; I&I!I/ : ; (  : ; I 8  : ; I 8  : ; I8 ' II : ;  : ; &I : ; I : ; .: ;' I : ;I: ;I .? : ; ' I !: ; I": ; I#4: ; I$4: ; I%.: ;' &4: ;I'.1@(1)41*41+1RUX Y ,1-1RUX Y ..: ; ' I@/: ; I0: ; I14: ; I 24: ; I34: ; I4 U5 U6.? : ;' I@7: ;I8: ;I94: ;I:4: ;I; <4: ;I =1 >41 ?4: ;I@.: ;' I@A: ;I B4: ;I C : ;D : ;E1RUX YF1RUX YG< H 1I1X Y J1X YK L4: ; I M4: ; IN4: ; I O!P4: ; I? <  nint!;2bt  3)(4;3 h0\3Wn4iJ 5t  !# " A(;3 Ib3;JU C d. tI ub v; w y\ z   #  #    @ b#  #0} Q Y #  ##T !b   5 $Y#  %#  G) - 9 .U#  vY# b# # #I BS B Rb?R`bkr m i # D b# (`# k#  r# E!U# -2fI(`.l>    \  I cidd;#rdu;#tcv;#aaw; #x; #qry;#x{;#cd|;#ad};#~;#ra;#=;#;# ;#;# T U9# V# W)# hX)# Y# 9 dI ae9# f# qg)# yh9# d2 Nv $ W X# ~Y)# ZTw_px#_ry)#_wz)# C{P# Q|P#_bf}Z# ~)# # # Q#$ #( g #, Z#0_up#8_ur)#< )&#@ 6#C_lbZ#D )#L O#P) )9) OO) ))  I6IF&\! # #  #  #B & #B )#B N#B #B ]#B9#9 " &  FjS B  cWk, mi o S     )  I  ) aq  S  ) )  d # # m# d # d # t #ext #t ) h w # S # q #  #  0 pad #  /\#+G )# b)# # )# G #id#@ /W #D g #` #;#M;# w # S # ^ #  # )# )# C# #_u #  #W 9g w    Q &   sinč˫& I Kr7N  A ina  r S$w af )#  " # m " # A   ?  sadsin I n0s)"sat )!"sa #inp#srv$$#ns)  D%vTTwT& TT)& U)%'<i<w<& <<)O= =)& ?)&!@&.Aiy'"(4 (?>)I)T)_)j*ug+ , , - h, , .)/s)0f)1u H2j)3WB40$g)5h3W`43Ws6)~7b7)7) 8buf28eom[9cp:=);<@A:W4Pw>\w,E^)[a^Ib^I?a4_[?b4_[?a6`a?b6`a  @)rg7 8buf7)S8ans 7)A! 8ns)?hpg&r<I<)<9)<;):z)9n)@ Biovx{Blen 9cp 9tmp CDTE D, , E|8,5PP<{<$F,$,4).)9)D)O4<>{ m 0Y_)_ buf``)ans` `)!a nsa)a 6a ?hpcg&dr&e &f)?nowg&g&'g&+ h &ai&j&zk)&k)?nk)?sk)DDo 6c) 7c  8bufd 7d) 8ansd 7d) <6f) :!f) Btryf) <f) :zf) 9nsf)W 9nf)<gvGr<i <j  C$C_Ckx5(:~)H5Hi:Iw<) 5~&J):)+49actS EP,E , ,,,,,,,,4))!*- *9>Es>Qs>]s>it>uu*|)**)HPH| E",=U40)I)T)_)j*u4I , , - `, , E xm, , J$@n,E 0, , 4&JB):B)49actES 5,&W)<u:(E08,$,4X).)9)D)OE x,$,4).)9)D)OJ , , Kp< Binu sBinas:)`9fd)~: L|.mrL/M )N FOPP1;PD;  bionic/libc/netbsd/resolv/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/common/linuxbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetres_send.cstddef.h_types.hstdint.hposix_types.hposix_types.htypes.htypes.htypes.htime.hsocket.huio.hsocket.hin.hin6.harpa_nameser.harpa_nameser_compat.hnetdb.hstdio.hresolv_static.hresolv_private.hres_private.hresolv.hselect.hresolv_cache.hin.h unistd.h4!tIKl$ Jw|HJ|JPKyzywJb(|J|JH,xJPv <gJhJJptoJJoJ LLNF4xteJqJJqJ L~NLH4xtgJJu$ J<HLQF~8GNLuJNIKz,x J0<MFJc0xsJ s JsJ JN~NGNL}us$~IKHLHL4IK0GMGMzJPzJP IKu<<IKwKu<kkib|,JJ|JOJJ|JKJJFJJ|J>JJ~J -=$u , uIK(uCMu <xJDHOsK (=KIKKLEM, QzJ|Jiy~ <`J|J J|J|H J bJ3<䃃(;KJzJJuIK$uKHLIKv n<JnJbJ{XLpX+^pZ . np! j @. ~L-z 0. / HP.,1 8.2 У0.2d4d6 H.7  H.*8& Ȥ.<XA8 P8.Rp8WN .cX_ @. qp8Zm H."p4pe| .$ppX H.&pp  X0 .(p0w 0oxp/>    &2AP "$&(*X]bgmrxd}|T4@H`Lp8@T$ +, &5:LVao  0EJVcovbionic/libc/netbsd/resolv/res_send.crandom_bindPerror.clone.0Aerror.clone.1send_vc$LC0$LC2$LC1$LC11$LC9$LC10$LC7$LC8$LC6$LC3$LC4$LC5$LC12$LC22$LC16$LC20$LC23$LC25$LC18$LC24$LC13$LC19$LC21$LC14$LC17$LC15$LC28$LC26$LC27__res_ourserver_p_gp_dispmemcmp__errno__res_randomidbind__res_nameinquerydn_expand__ns_get16__ns_samename__res_queriesmatchstrerror__sFfprintfgetnameinfostrncpygetpeername__res_nclose__ns_put16__evConsIovecstrchrwritevreadfwrite__res_pquerysocketconnect__res_nsend__get_res_cache_resolv_cache_lookupsend__evNowTime__evConsTime__evAddTimememset__evCmpTime__evSubTimepselectrecvfromgetsockname_resolv_cache_add>  @D`HY !%1>ELSXeju$/@KValw1=KZeq!,7s !'.:@FLRX^djpv| ;\m~-;P[gu '5_mGR_m|5 ; A G M T _     , : H          , : H c q            8           6 B [ i     $5`k !-9EQ]~       *CHRW\gpz  $ ( 1<BG`eq     %+0INZlpt htx| *:JUc #5QV ".:R^jv $)49ITiy #.3CLXchx,:CQZcg16BMRbjs-1Vapu  " v -#?? @??\ A B C BD B` C B C??x E F F E@ G?? E  FH F` D?? AL I` Jh Kd p A??0 A` A L I J K   AD ML` M@ d?? J4 N< O@ PX Q R Q S T$ F T A A    OL JX O T@ U< !( !D!` V A A  "" O O W8 AP X l X UP ## W O$ O\ Oh Ox A K $$ O @, OX Od A| A %%  A A  && A4 AH 'L'T ` A O A A ((??` Ap J J U )) V Z [ J LP WT \ ] ^ _P `p a b c A d Up ** V ] Ox O O A   , XH A\ +`+d p O O Ax U ^ A , , Uh - - V @H H Ut . . VX e O @@ Oh @ O A //  J U 008 V\ O K 11l O J U 22 A$ 3,3< O@ JH KD $P$` O A A A 44  Ax O U 55 A 66 A 44  4 O|  J J V@ O O O J U 77  fL U0 8P8p V Ut 99 A @D hl   PT D l   T     $ + / > B I M T X g k r v }                        $ ( / 3 B F M Q ` d s w                        # 2 6 = A H L [ _ g k r v ~                        + / 7 ; L P W [ b f m q                            # * . 5 9 H L S W ^ b i m t x                 "&59@DSW^bqu +/6:IMTX_crv~  #*.59@DSW^bko #'/3:>FJQU]ahltx      " & - 1 @ D K O V Z a e l p w {                        " ) - 4 8 ? C J N U Y ` d k o v z                         # ' / 3 < @ H L U Y a e n r                             ' + 2 6 > B I M U Y ` d l p w {                          $ , 0 8 < C G W [ b f m q x |                         !(,37>BIMTX_cjnuy "&-18<CGNRY]dhosz~  #*.59HLUYbfw{ +/6:AELPW[bfmqx| "&-18<CGNRY]dhosz~  '+26=AHLSW^bim| !%48?CJNUY`dkovz (,48@DLP`dko~   ( 08@H       $ 0 4 8 < @ D H L P T X \ h l p t x |                                $(,8<@DPTX\`dhlptx| (,048<HLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $048<@DHLPT`dhlx| $(,8<@DHLX\`dhlx|         res_state.o/ 1331265336 1002 1002 100644 14680 ` ELF!P4(0- (   % RU$ > $ > : ; I $ >  I : ;  : ; I8 I !I/  : ;  : ; I : ; ( &I : ; I8 ' II : ; !I/ : ; &I : ; <  : ; I : ; I 8 5I : ; .: ; ' : ; I .: ; ' I !4: ; I".? : ; ' @ #: ; I $.: ; ' @%: ; I&4: ; I'1X Y (1).: ; ' I@* : ; + ,41-.? : ; ' I@.4: ; I /.: ; ' @ 04: ; I 14: ; I?  Veint2Wk40knWe3LH5^ w%>W209Ct>uW?v0w~|y1!WIs |$?# %s#   -  .#R   ?#  W# ~ #  # >      $ -  = -  =  M 0 h  #^]x>] T   U# 5 V #  W)#  X)#  Y #L dT u e#  f # . g)#  h# J N  W  X#  Y)#T w_p x#_r y)#_w z)# ^ {E# 8 |E#_bf }e# ~)#  #  #  #$ Q #(  +#,  e#0_up #8_ur )#< 1#@  A#C_lb e#D T )#L u Z#P)))ZZ))  )& >A  >Q % \!  J #  #  # W !#B  1#B  )#B _  #B L #B  #B  #  " ! 41 Q B\jo,kHmo)T);qo  ))IJ? # # # # #ext#   ) ! 0pad ?  /\#+ )# E)# )# )# S #id#@ }0 #D @ #` )#0#0# P # >` # z# *# )# )# ^# 9#_u# p # 0  @  P `  p \  )P)a$ N@ # A # B #$0  [D7P 8)# 59P # *:0#F_pi;` #F 

 < &rtϥ -' P, &rtƥ L.&)/l$0K.5 0M0}/5 .4 .5 15 bionic/libc/netbsd/resolvbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetres_state.c_types.hstdint.hposix_types.htypes.htypes.htypes.hsocket.hin.hin6.hnetdb.hstdio.hresolv_static.hresolv_private.hresolv.hpthread.hsystem_properties.h_system_properties.hin.harpa_nameser.hwJL $I  <T+}=vLKtuKuKuKIK<'!'!D D D &!   'net.change<'!'$ $ $ $)@!@d#B@ C`# $ G`# &@$! (' D$@d#$Y% ! $ !(!$ D$!@@!@@`#@ %@d#B I`#Ih#D&!( \!$$ !(@<'!'Y$ @h#B$ '<'!'Y$ @B$ '<'!'Y$ @ 'b$ '<'!$ $ |  tP HxP(P<P D<P DPP D $ |  $tP H@xP(P`<P Dx<P DPP D $t $T l`x(T\`\`R``` R x`< 04R44R< 04R44RP 04R<HRg __res_put_stateq __res_get_static __res_get_state __get_h_errno| _nresLtx<<P$tx<<P$ndotsnscountsin_portns_s_nss_proto__get_h_errno_nresres_send_rhookh_addr_ptrsbionic/libc/netbsd/resolv/res_state.cu_int32_tlong long unsigned int_lbfsize__u16defdnameres_doneGNU C 4.4.3retransres_nextnsns_s_qdlong long intsigned char_ubuf_bases_aliases_cookielong intpanicres_modified__be32_res_threadservent_blksizehostentuint16_tdouble_offsetin6addr_loopback_res_thread_freehostfoff_t__uint32_tmaskoptionsns_s_prres_errorin6_uns_s_anres_static_readvaluens_s_arfpos_thoststayopens_addr_close__u8_serial__u32_file__res_get_statenamensaddr_listservent_ptrshort unsigned intsin_addr__padres_send_qhookh_addrtype_res_keyshort intnsorthost_aliasesu6_addr8_res_thread_alloc_writesin_familyunused__res_get_static__res_stateqhooku6_addr16s_porth_aliasesu_intretryin6addr_anyfloatns_s_zn__res_put_states_namesa_family_res_init_keyh_lengthh_addr_listnstimes_res_thread_get_rstaticaddrunsigned char__ns_secthostbuf_h_errnores_h_errnou_short__sbuf__sFILEres_stateFILErhookin6_addr_padsort_listuint32_t_seekhost_addrprop_infolong unsigned intdnsrchchar_sizeunsigned int_res_once_ext__uint16_trstaticu6_addr32pthread_key_t_res_static_donens_s_max__kernel_off_tres_goaheadpfcode_vcsockh_name__res_state_extsa_family_tRESET_STATEsockaddrsockaddr_in_flags/u/raghu/ics_feb29ns_s_udserialnssocks_nbufsa_datau_charu_longres_sendhookact__be16in_addrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__res_put_state.rel.text._res_thread_free.rodata.str1.4.rel.text._res_thread_get.rel.text.__res_get_static.rel.text.__res_get_state.rel.text.__get_h_errno.rel.text._res_init_key.data.panic.4189.bss._res_key.bss._res_once.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 (.8.>8Lp8^p Z `.@. npYj 48. z@Ht 40.2 x 5.@< 5 .|< 5 . P  60.%$! @68.9,J0X0kp0g x6p.|x 68. pj 7."pk 8.$pmP 8@.&p@ 8p.(p00o\)p/& ,[   't8xHR$`i "$&(*t+,y  <$<4PBU\#bionic/libc/netbsd/resolv/res_state.c_res_thread_free_res_thread_get_res_once_res_init_key_res_keypanic.4189$LC0__res_put_state_gp_dispfclosefree__res_ndestroypthread_oncepthread_getspecific__system_property_find__res_ninitpthread_setspecificcallocmemset__res_get_static__res_get_state__get_h_errnopthread_key_create_nres&  @ `234    !%3 : A H M Z _ l s z                 * 5 @ K W e           N Z i u {               * 8 F [ f r         $ 2 @ j x   R ] j x        8 Q W ] c i p {   # 1 H V d        ! < J X g y                     #  A  g  r                 (  ,  0 B G  M  V  Z  a  e  s  ~                       6  ?  [  g l  x }  6 # A ''( (< )L *` )'', +$ 0( <D ,Ld - . !!   / 0  - !0!H 14 `d /''  ''  ''  < D'' 5    $( @D `dx| ( D d|     $ 3 7 F J R V f j q u |        ,08<LPW[   (08@       $(,04res_cache.o/ 1331265336 1002 1002 100644 54748 ` ELF}P4(IF (@(P`((0?@0?8?(@?@% RU : ; ( : ; I$ > $ >  $ >  I  : ;  : ; I8 I !I/ &I : ;  : ; I : ; 5I : ;  : ; I8  : ; !I/ : ; : ;I8  : ;I8 : ;I : ;.: ;' I : ;I4: ;I  .: ;' !4: ;I": ;I#&$.: ;' @%4: ;I&.? : ; ' @': ;I(.: ;' I@): ;I*4: ;I+ U,1RUX Y-1.41/1X Y0411 21X Y31RUX Y4.1@5164: ;I 7.? : ;' I@84: ;I 9 : ;:41 ;.? : ;' @< = U>4: ; I ?&I1#T HID{(N)int0o52/44V(h 1d3}5134 o Vx D#oc@dto wp !   { $p# X %#  I GO  aA .## ?  p /   ./  9?   Z i #   ` O# h D#) *#O1 +^Bn XE$ )g K0n} %o}# ;o}#_idp# Ap# p# q# #r#$ !sO#( `t}#, Z   } uh # # T#ttl# # }# +   9 <rO# sO# tO# uO# ]v# e w# x# :y# { < O ` #end##  (V####  #O##O#O# idO#$  @DO#FO####0V#4O#81D#< Hw@ ##r #M## 9#0   J V    VGGVpendcO  4VGOVpend RG GOp%OGp6VF6G6Vlen8O yGO_@V@G!BV!CO S-"e-D -D!/D   !A  p1 ! lq  "nOai!A L cO  c"ncOccOleneOnsf!A g & "e&D ) "eDO2 ! O!*2 B [m m  !  !A m  !r m o A !Z E A EiGOgcO tveZ O\ GpendcOd2O 2Glen4O;V "e; !c =    PO$ PGpR!SO!SO!qSO!"SOgO gGigGp1i!jp2k!lc1oOc2oO O GiGOp1p2O GiGOP GiG! O! OpO "e1p "e2p !r !ir f r fg eiD D tw r w! yD!z ekkO!Q !!OnO! ettlerr+ q#WDvW WkWOeYD!*ZO GTr TU "eVDO1GO kp$JC[%envE &6>' ^!*O( : |I'r :)key;D!@=O*> +!AD,P F-m -b +8.x . /FxH-l-`-T/Fwl-l-`-T, Pz-+ - +x07 0C / 8,M- - /$ 8-B -6 180N T0e .Y .p 180} . 2 ,- - - 1,. . 3(w--+.3$--+.3-+0./--1.3P-+x.2--1.4|595b0&-(FO`5)eFD' Fk'FO6c H H3 <Nq- +. 3y@@O-+00,3@PV--+.3x0S{-+H./V--1.2TZ---!1T.93M`; -k-w-_+x0J.2(:-- 1(.$..1(0;2F<@?-l-`-T3 `R- +. 0 . . . ,\ -n +.z 2 `6-- 1`09 30C Q1h0P o2FtxP-l-`-T7 D'r m ' k'O'', O<'~!c  8key@!@O* %eDnowO* D9/ H1: / (`- - 1(`0 \3 , p- , 0@n- 3 `- ,--+0o  ;9'r m ' k'O'k'O<8keyveD* %ttle9/ -- 1 :%w01 0=G .G.S:_w/ - 1. 0 p 2 - - 1. 3 nx- , p- /r ---1 ..3 +: v,( ---,XZ--+0 d !A 7z '  %ai ,T-+0 29T-K1T.W7 1 p%ai Q ! ,T-+0o 29T-K1T.W&7 < '  ' *A  29\-K1\.W N !r m Tr nnOnowO! !D&RB '  2`T-1`T0F /B `-T 1`0` Y 29`-K1`.W,8-+P0 w .+< Z08 1.E2 - 2 1: X7~ )n~O *  ! ,1 Xh-O -C +.Y 0d  29-K1.W7SOx- )nSOM 'Sv 'SO ! U* VO ,q h\- - - - +. 0 0  29l-K1.W(qm " 5' qC *r vm /B 8v~-T 180` 298x-K18x.W+!A x=len|O, - +80 /s x1. , Pz+x. , +0 :% 7 Rm *r Tm ;* ZN1`*A _l&y9 ' '6'O%i O&rt O*@ OD6| !<6 " *A *b/9*Y -K1.W2 .- 10  ; !'V* *r m = *A /,-+0 M.+<[!08`1.E2 - 2 1: X&B?|~"! 2`L-1`L0/B `"-T 1`0` 29`-K1`.W,-+00 .+<"081.E2 - 2 1: X>."??>/"6 6HV6 !6$e  bionic/libc/netbsd/resolvbionic/libc/privatebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetres_cache.cresolv_cache.h_types.hstdint.hposix_types.htypes.htypes.htypes.hsocket.hsocket.hin.hin6.htime.hpthread.harpa_nameser.hnetdb.hresolv.hin.h uAKIK=Iu $GMIIKIKI=L <KL> wJ~K~J|t JsJsJ $J |<K|iJiK JsJK JJJwJ3Jy4LL?KKyJ$}JQ}JKJ}JxJ}JJJa*| vJKPzJRKLKJ <xRxR1T0 <uIK g0|<KIJ<}}JKxJRxJIK||HKMKKLGMMyKLJ|JJ~J}JJ}JJ}JzJJJ~J}J$GMI~EtxQyJr JwJ$I~EtkJmJqJkJ(I~~Et; 0IKI3Ert`Ju>~JJ J{JLHKJv$(FNIuJ~Et0=ILEtIKm JvJ$ukJ( 0_&ErtJ(lJJ|$umIKIJ|JJ|JJJ{K HKz zJ>lt<>NE0<K>KElLHKG=MKK$zJJ x0 4GMIKxJ>u>~JJ J|JKJq(zJ 0IErt`Ju>~JJ J{JLHKJk$BIONIC_DNSCACHEro.net.dns_cache_size%u<'!' $@ ! @@e$$ `!( @$D$!(  ' '<'!'$ !$ $ $&!(@P$!  @ $$&$  ('<'!'<840,($ <!@!(!!vЎ<r!&m<hL&PI1 &!+x !Sr$B$+pb+h` nQ$+q!`c $!@$FR&1&++ q  d+0T+83F(D&(%&@(@!+H !+Pr @&` +4@+ S`"K!0@K@G($&E&!!+@+@r$+h$+`q $@'<!840,($ @'x~%Q$+q EC%w<'!'$ !$+q @ $@$$ ('$! (' 7<'!'LHD@<840,(!8$  $+0 `%  <h1]#5+4@&@r%X.`<%+ 0 6$+#@Ð`$++G+ qאc$&@`$+G!0@C`F$@s(`!+ ! q^B$G&@>$#!0k%`+ $+`1   !LHD@<840,(P'R%C < % %%$ %u%'!` +EC`B$@y( !C#C!CB$`@d(!C+E!! !(!`  @! !@ !( @! !` !(@!1& $!@ !(@! !@ !(@! !@ !(@!! <'!'\XTPLH '!Y$!  ! @\!!XTPLH`'02& ! @!(y$ ! P/!@' !( * tp*h ! ! @\!XTPLH`'  L $j (%'$ ! `3 p ?& d 8C 0$<'!@' '!Y$! !  @'02& ! @! &! !(C`!@ ! @'&%* #!H'! !(` !0@Vx'!!!8!&**!`!0!  $@+x % ! D   L j I(%'!(! ! M!@`4(&! $ @!@4 (I$0!0JI_ ! !8! !(!0` ' !(8$63$!e&>&"$ p 84t0<'!'$ !$ $ D& P!  !( @  D&$&! (' D&$!! ('<'!'$ $ $ D&P1&!  !( @  D&$&! (' D&$!! ('<'!',($ !!$ $ D& PD& !  !( @cD&,($  0'<'!'<840,($!$ $ D&< P74!  !( @,(0& ! ' !(@!!<!ud  cd&*0(&&8 !  D&<840,($@'<'!',($ !$ $ &#&b, @! &,! ($ 0'Ҍ@s&R@! @ !(`@@ '&!QQ<'!'40,($ !!$$ ! &#&b,@@ӌ`&s`! ` !(@ `'&!qs` ! `*U!@ &4!! 0,($ 8'!(`! @ !0@!Q& @4! 0,($ 8'<'!h'|&!1&0@$!  !(`@ @$!|'@$ $ @!@!!|'@$ $!@4@!@'$ !(%@ !  @!(@ ($@<$40& !(&T!(`! @ $@! 1 R@$@$ !  ! @!<'!'$ $ $ &b@Čd$y$ & !@$!  ('d$<'!'|xtplhd`\X!!$$ ! d$Y$ ! J ЌEA!  !( @:!!$ $ s&0'!  0 t1& $8' $(,04%!  5$!!'$ & !D!(!0 !8`@`1&5>R& %|xtplhd`\X' D&` !X b&<'!'<840,($ !$ $ $&@bD@$$ ,@!@0R$ ! @4!' !(@!!<!  &*P@(& &4  8 ! @ $&<840,($ @'B@F! @<'!'<840,($$ $ D&P81&4!  !( @,(0& ! ' !(@!!<!ud  cd&*0(&&8 !  D&<840,($@' | P DP(P0P@h  |P(L0`PPh  $P`X0P h  P(PP(P P0T(P@\ P0T(xP8\(P\P(L0Ph  (P@`(|P@\ | P D,P(P0LP@h  |P(L0`PPh  $P`X0P h  0P(PPP(P pP0T(P@\ P0T(xP8\(P\<P(L0\Ph  (P@`(|P@\ 0<RDxR( 0T0b \T `U`HglghLflf|Dnltn|n|R ,R8@RR|daSdSDbD\d\\b\pTpaTa8b8TdT\b\lSlb|cbcR\a\|U|bUbU8a8XcX`a`lUlRa|<VPpVRR$R8V|( (T(\`dt` DUd|U(DTd|T` |TT UU pVtXX<[[@DWD|\|Z\VR4V4HRHTWT`V`WZ\Z8\\hSa`aRdRUhUSxS @T@laxa(a HU HV HWHdcxc(c ^pp|^| _pp|_|Rd(pd`(H`hh`p`Xp` `Hh`hp``,TThh PTPaa a \U \V \W\|dd d ddcc  cR eSfPdfdxSxfS4S4fSnDnn`T`,`RRcc( 0T0aa``d``(``\``0 4T4a 8U8cl` <T<aTxa|`p`T|`ldcpc0 4T4laalaahbbx8 <T<aa @U@b$@b XVXeeR$lac$dccc TTTccTc```D```@aaaL`RR(aTTdTT HTHaa LULbb `V`eehaaddd``xcc @T@pccTT`R|`|RRhedld|t`h`Lt`ddchc5#[_resolv_set_default_iface5_resolv_cache_lookup_resolv_cache_addd_resolv_get_addr_of_iface_resolv_get_addr_of_default_ifacep_resolv_set_addr_of_ifaceT_resolv_flush_cache_for_iface_cache_get_nameserver_addr_resolv_cache_get_nameserver5__get_res_cache_resolv_set_nameservers_for_iface _resolv_cache_reset!_resolv_flush_cache_for_default_iface|`x||l88l8ll8l8(,04(,04$(48,0$(48,0| | l|l|<Dl`<Dl`@Dl`@Dl`@Dlt@Dltx|x|(T(T`t`x`t`x`D(@`D(@,0X\LT08HL<DTTTT48H48HXlXlh$@h$@PPx,0@,0@,0@,0@|`x|pnodeai_familycountbionic/libc/netbsd/resolv/res_cache.cai_flagsns_s_nsnext_dnsPacket_rewind_dnsPacket_checkQRresolv_cache_infoaddrinfo_sections__uint8_tentry_init_keynameserverstype_dnsPacket_isEqualQRanswerlenns_msglong long unsigned intqdCount__get_res_cache__u16ancountentry_free_dnsPacket_hashBytessocklen_tentry_mru_addin_addrpack2_insert_cache_info_lockedlong long intsigned charbuffResolvCacheStatusanCountmru_list_dnsPacket_hashQRentry_equals_dnsPacket_checkQuery_cache_get_nameserver_addraddrLenlocklong int__kernel_time_t_flagsCache_flush_cache_for_iface_locked_get_nameserver_addr_locked_create_cache_infoExituint16_tdouble_cache_flush_locked_res_cache_list_lock_free_nameservers_lockedin6addr_loopbackmru_prevbytes_resolv_get_addr_of_default_iface__uint32_tu6_addr8_res_cache_listns_s_pr_msg_ptrin6_ususeconds_tRESOLV_CACHE_UNSUPPORTEDvaluens_s_arrdata_dnsPacket_initmru_nextunsigned intnumBytes_get_addr_locked__u8ai_socktypelong unsigned int__u32lookupnamebufflen_msgsizeshort unsigned intns_s_qd_res_cache_initlast_dnsPacket_hashQuery_cache_remove_oldestpack1timevalquerylen_countsrdlengthanswer_find_named_cache_locked_resolv_set_default_ifaceexpires_find_cache_info_locked_dnsPacket_isEqualBytes_sectns_sectentriesnsaddrinfo__be32__ns_msgGNU C 4.4.3tv_sec_time_nowdnCount_resolv_set_nameservers_for_ifacemax_entriesu6_addr16u_charai_protocol_get_res_cache_for_iface_lockedresolv_cache_dnsPacket_checkBytesin6addr_anycursorpacket_rrnumRESOLV_CACHE_FOUND_eomtime_t_cache_add_prr_classai_addrlenfloatns_s_zninitsa_familyifaddr_resolv_cache_create_resolv_cache_get_nameserverhlink_res_cache_get_max_entriesaddr__kernel_suseconds_t__ns_sectnodeai_addrshort intinfoEntry_dnsPacket_readInt16ai_next_resolv_flush_cache_for_default_iface__ns_rr_get_default_iface_locked_resolv_cache_addend1end2_dnsPacket_hashQNameuint32_tanswer_getTTLin6_addrserversentry_alloc_cache_remove_pfirst_dnsPacket_skipcharlast_idarCountcache_size__uint16_tindexnum_entries_resolv_flush_cache_for_ifaceu6_addr32_resolv_get_addr_of_ifacenumservers_dnsPacket_isEqualQueryns_s_maxentry_hashgenerationRESOLV_CACHE_NOTFOUNDhashunsigned char_dnsPacket_isEqualDomainName_resolv_cache_lookuppthread_mutex_tcache_info_get_nameserver_lockedpacktv_usecsa_family_thintsDnsPacket_cache_lookup_ps_addrentry_mru_removeifnamequerysockaddrcount1count2uint8_t/u/raghu/ics_feb29ifaceoldest_resolv_cache_reset_res_cache_oncens_s_udanswersize_resolv_set_addr_of_ifacehandlesa_databaseai_canonnamecache__be16ns_s_anlistu_long_res_default_ifnamens_rr_dnsPacket_checkQNameresultsbufGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text._res_cache_init.rel.text._resolv_set_default_iface.rel.text._cache_lookup_p.rel.text._dnsPacket_checkBytes.clone.0.rodata.rel.text.entry_init_key.rel.text._resolv_cache_lookup.rel.text._resolv_cache_add.rel.text._resolv_get_addr_of_iface.rel.text._resolv_get_addr_of_default_iface.rel.text._resolv_set_addr_of_iface.rel.text._resolv_flush_cache_for_iface.rel.text._cache_get_nameserver_addr.rel.text._resolv_cache_get_nameserver.rel.text._get_res_cache_for_iface_locked.rel.text.__get_res_cache.rel.text._resolv_set_nameservers_for_iface.rel.text._resolv_cache_reset.rel.text._resolv_flush_cache_for_default_iface.bss._res_cache_once.bss._res_cache_list.bss._res_default_ifname.bss._res_cache_list_lock.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 <G>Lp:^p5#Z ̒@G np)i j G z2p2,2 xG@3 G3 (G6| G  7 @7` ԫpG.:* DXGM\<I Gi`?e $GT@ G@A \G!B G#C G%*Dx& ,G'QEM ܰG){Gw lG+H G-J G/L| G1 N N@5NNNlpNh \ G7}Py |G9pS `G;pd lG=phf tG?pg GAp0n 0yoyy<H8 @   '75K@4[6p3|`!#%'))+-/1345679;=?AC  ( DE5BU]ry!9#W%rx'+-/|1bionic/libc/netbsd/resolv/res_cache.c_res_cache_init_res_default_ifname_res_cache_list_res_cache_list_lock_res_cache_once_cache_lookup_p_dnsPacket_checkBytes.clone.0entry_init_key_get_res_cache_for_iface_locked$LC0$LC6$LC7_gp_dispgetenvatoimemsetpthread_mutex_init_resolv_set_default_ifacepthread_oncepthread_mutex_lockstrncpypthread_mutex_unlockmemcmp_resolv_cache_lookupgettimeofdaymemcpyfree_resolv_cache_add__ns_initparse__ns_parserrcalloc_resolv_get_addr_of_ifacestrcmp_resolv_get_addr_of_default_iface_resolv_set_addr_of_iface_resolv_flush_cache_for_iface_cache_get_nameserver_addr_resolv_cache_get_nameserverstrlen__system_property_get__get_res_cache_resolv_set_nameservers_for_ifacefreeaddrinfosprintfgetaddrinfostrdup_resolv_cache_reset_resolv_flush_cache_for_default_iface =@`CGKM N@O`PQTUZ [ ///!.%2/8/>/E/Y/`/e/r/y/~/////////////////$///:/E/P/[/f/q/|/////////@/L/[/g/u/////////////// /)/7/E/S/a/o/////// /,/=/I/W/e/s/////////'/6/E/T/c/r///////////&/5/K/W/d/s////// //N/`/l/x/////////"/./G/U/a/m/z///////// / /% /2 /D /e /r / / / / / / / / /& /C /U /a /t / / / / / / / / / / /. /] /o / / / / / / / / /% /7 /C /Z /q / / / / / / / / / /, /8 /D /Q /y / / / / / / / / / ///&/2/H/s////////////2/: > B+V+]/dhl+u/+//+/++//+./..)-MQqu..++++ +!8<RV.l.|......"48NRV+c+l+u+/++/+/+/....+(+15.K.[_.p...+$(7;D+TXvz..+..++ +7/CGK+T/_+d/o+t/+/+/+/+///++/+/%)59MQgkt+}.....+/  +/%+*/5+:/E+J/U+Z/e+/++/++  $2+;?QUcg.}.....(.1+:/L/X/f/rvz+/++..+/++/*..;.D+MQ^br/y}+/+/+/+/////9/F/V/]ae+n/y+++. .+#0+59GK_cko/++/+/..+ !/-15+G+L/W+\/g+l/x/+..++/+ /+/(+15FJS+\`mq./...+.. .."+7/C!G!K+T/_+d/o+t!x!}/+/""+/+/+/++/+ / /! /, +5 "9 "J "N "^ "b "o "s "| + / # # + / + / + / + . / + #!. !.!+ !#$!#1!+6!#:!#H!#L!#`!#d!#l!#p!#!/!$!$!+!/!$!$!$!$!+!$!$!$!$!+!$"$"$"$$"$(".5".>"+H"$L"$Y"+^"$b"$p"$t"$"$"$"$"$"/"/"/"/"%"/ #&#/#'##/0#( #/GG!"#$88 9 1$10 :D 'L'P ;H &T&h' < ((880 >$ 4 , %@%H ?P(` @d'\ '|' A8 ((88 B B B888 B88$ <( 0D0, 0H00 0L04 0P08 0T088, 8x ?  D E A, F88< H ?  A  Hx I F H A$ JT E E D880 >$ 4 , %@%H ?P(\ &`&h A| A L A( A8 ((88, >$ %0%( < D ?L(T &X&` 'h't Ax L A( A4 ((888 >0 %<%4 H P ?X(d &h&p Ax( A L A A@ ((88< >0 @ 8 %L%T ?\(h &l&t A A L A ? D F4 AT AD (\(884 >( 8 0 %D%L ?T(l A< (t( && '' L88@ >8 %D%< H \ ?d(| && '' A L R A($ @@ AL (D(888 &<&H J\ J` L| J J S 2$28 :P Jl < @ F F88( > %,%$ 8 @ ?H(P 'T'\ &`&p' 0 (( A'88L >H P D %T%h ? ( (d (p(x | && L L F V W 3H3x X A (( Y88@ >4 D < %P%X ?`(h 'l't &x&'  ? D F@ AP AH (X(888 >0 %<%4 H P ?X(` &d&l 't' A L A ? D F, AL A@ (T() ,)0L)P))))0)4P)Tp)t))))<)@!\)`")#)$ 0P4Tt@!`"#$     $ + / >BJN^bim|  $+/6:AETX_cjnuy"&-18<CGNRY]dhosz~ %)9=DHOSbfmq,07;JNUY`dkovz $37>BQU\`osz~ ")-<@HLSW_cjn~ !(,37>BIM\`osz~ ")-<@HLSW_cjnvz     " ) - 4 8 G K R V ] a p t {                       " 1 5 = A Q U \ ` o s z ~                    ! ( , 3 7 F J Y ] d h w {                       - 1 9 = M Q X \ c g v z                       " & . 2 C G N R Y ] d h o s                     !!'!+!;!?!N!R!Y!]!l!p!w!{!""""""""""""""""""" """&"*"1"5"D"H"O"S"b"f"m"q"""""############### #### #/#3#:#>#M#Q#`#d#k#o#~$$$$$$$$$$$$$$$$  (08@HPX`hpx!"#$  $(,8<@DPTX\`dhlx| $048<@DPTX\`dhlx|  $048<HLPT`dhlx|  $(,04@DHLPT`dhlpt(,048<@DHLX\`dhlptx|  $(,8<@DPTX\hlpt  $(,8<@DPTX\`dhlx|########### #$$ $$$0$4$8$<$H L PTX\`dhlptx|!!""##$$nsdispatch.o/ 1331265336 1002 1002 100644 7012 ` ELFP4(!P% RU$ > $ > : ; I  $ >  I &I ' I I  : ;  : ; I8  : ; I8 .: ; ' I : ; I4: ; I.? : ; ' I@: ; I4: ; I4: ; I1RUX Y 1 U414: ; I? < >0@intip400)TJ5S Z(fo ) u$ srcv#w#~x#Oy T##z/ [[[[\~\^) $ o)wo!okop'paprkis)s)tWu)cbv~w._{p  T0c0] bionic/libc/netbsd/netbionic/libc/arch-mips/include/machinebionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/privatensdispatch.c_types.hstdint.hstdarg.hnsswitch.hunistd.h< =I^,JFWJ+UJ>(KvJLr,IKf0J,<'!'LHD@<840,(!!S`QOŽ?@!!!B$C`&! &d'D1$!! ŏ ' ' $@ ٌ Ō!  !0ǎ0I$@Is&tR&B0@LHD@<840,(P'!L$HD@<840,(P'L$HD@<840,(P' | 0PPh   | 0PPh   LTLLaXaTaT LULP`PXUX`U`U VVV WWW LL8f8XXtftfDcXcRR ,RXhRRp@dX|diiiiUUUnsdispatch__page_size_nsmethodshort unsigned intdoublebionic/libc/netbsd/net/nsdispatch.cfloat__gnuc_va_listunsigned charretvalcb_datasrclistdatabasecallbackuint32_tva_listnss_methodlong unsigned int__uint32_tresultunsigned intflagslong long unsigned intnsdispatch__builtin_va_listdefaultslong long intGNU C 4.4.3charns_dtabsrclistsize__page_shiftshort intns_srccurdispdisp_tablong intmethod/u/raghu/ics_feb29signed charsourcenameGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.nsdispatch.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxL^pZ  npj  ~z  pTD D pW p3 ! pT  pt P pp0 0  o    xD   % 09bionic/libc/netbsd/net/nsdispatch.cnsdispatch_gp_dispstrcasecmp !%3:AHOTahov}%8FU`q|        ( 7 D IS Xcm {   j         ! % , 0 7 ; B F M Q X \ k o v z                          " ) - 5 9 @ D L P W [ k o                           . 2 9 = D H         $ ( , 0 4 @ D getaddrinfo.o/ 1331265336 1002 1002 100644 85988 ` ELFP4(MJH80(x0hH$ % RU$ > : ; I$ >   $ >  I  : ;  : ; I8 I !I/  : ; (  : ;  : ; I : ; &I!I/ : ; : ;  : ; I 8  : ; I 8  : ; I8 ' II : ; &I<  : ; I : ;   : ; ! : ; " : ;# : ;I8 $ : ;I8 %.: ;' I &: ;I'4: ;I( ): ;I*&I+4: ;I, : ;-.: ;I .4: ;I /.: ;' 0.? : ; ' I@ 1: ;I2.: ;' I@ 3 44: ;I5 U64: ;I7 8.: ;' I@91RUX Y:1;41<41=1RUX Y>&?: ;I@.? : ; ' @A: ;I B4: ;I C : ;D : ;E1X YF G.? : ; ' I@H4: ;I I1X YJ UK41 L 1M 1N: ;I O41 P4: ; I Q4: ; I R4: ; I? < -B4 int-; Y 2bh4;s /1  3W?5is  Ib;  z CtIDub v;7 w y !b   A $P# F %#   G) l n  P#  #  k    n}m"!x - > !.( /W)23{ _ k= , -  .# $  P# C b# n# # I  H   (   (  8  Q  S  # P   b#  #  #  8# = !#^,t h kd b 09 q 4  ?  9 h K  0 xI[5 b j LZ r  ? c     q tX  L     !"# $ %e&$'()**U   =4 Qo c4idd;#rdu;#tcv;#aaw; # x; #qry;#{;#cd|;#ad};#~;#ra;#;# ;#L;#D;# 4 LT U# V# W)# 4X)# jY# d e# 8f# 8g)# Sh# qZ r)# s)# t)# u)# v# w# xZ# 4y`#[Q(N W b X# \Y)# &Tw _px#_ry)#_wz)# : {P# |P#_bf}|# ~)# #  # ] #$ =  #( lB #, |#0_up#8_ur)#<  H #@ X #C_lb|#D N )#L lq#P)  ) ) q q) )7 7 )=  IX  Ih * \!  #  # ' # 8 #B H #B )#B 7 #B #B ?#B  # ' " 8  EH h ju 4C  kN Ym  u     )  Z)q  u   ) )   [E | n# # L# \ #  #ext #  ) | 0 pad E /\#+& d)# .)# _:# L)# &#id$#@  6#D ~F#` :#;#k ;# V# q f# /  # 6 # %)# )# : /# /#_u # <v# 6  F  V f  v s   ff o) usrcv7 # w# zx#y0 7 # d# p oh<p[inqin6rSp s; afd w)# )# )# =)# 7 # 4 7 # )# 5 )# )# )# }7 # )#!Whdr4bufW h 5  # 7 # )# )#  # )#n)#s"(/#ai`#$)#$ h#$s)#$%d)&a1d&a2d'p1f7 'p2g7 'ih;('xk)'jk)Q 8%M)&pM7 'epO'vP%f k)&aik)k7  %22&af)'afd28*afds%:)w&pai:&ai:`&str:7 %$))))+ :'a6'ep, SE8%])c&pai])]7 &res^c's`)'afda2'curb`+L c+d),`%)&pai) 7 )7 &resc'afd2'cur`+)'cp+^++| +(+%E%)&pai) 7 ) 7 &res c+"`'cur#`+$)+%,Q  %))|  ) Z+)'ret)'len-~)?.? +| hPS-).+| h$%J)G) 7 )l&res'cp7 +G'hpR+/+s)'ret)+)+ )+)+ )(+A )M7 4/ ) `'cur!`+ ")'i")+#,J(+5)/I) H % `) ) 7 &pai'p'cp+K+++`'res`+)+| 7 +' ,F ,D/ ) 0,7 014)2 )d1|  3 lM+d4na<56ViZ7t+j?2 )01|  x5+j2{B),1| B 7 ,+Gj8u)1U 1Z 'a1 'a2 6W )i6Y)|+)6+)6d)+)6T)+ )+ )6!) +& )+ )6)(6)Q6)6)7+j+1j+vj+j9/0:L:A5H;W;b8bu)?aiu1u7 1u)6w7 D4spxm6 y)+ z)=:5<<8! J`69?paiJV?afdJ2t1| J7 'pL'aiM`@pr?ai<`6>`8)4?pai"1 7 a17 ?rescAg7 4afd244cur`sBL 6)B CTDbadT98e::9t(:5@;%EA:j:_:S8Ne) &?pfe) 1| eZ 1Te0B 4sf)k 4reti) 6 m) %D){) 7 )7 )&resc+)'one{+" + 7 +H + )++ , 8+)'ai`+cF'_rc)(+'ai`+4 +FG+ViFY+ViFk+| Z(+V!i)    [G)t #1 L7  1L7 \ 1Ml ?resMc BL O|4curP` 6Q)HaiR}'ai0S'paiT`4exU#DbadCCI It ::9iX!::::{5<<;;<<O;;9 *!::J!K =w +:::5P;;<LED :7D;%9|:":::5< <*;6;B;NMZIP":7P;%E|::9&tb#:\:P:D:85)5Kv~OY=x5K2~O  9*:::5<#<#K<$<$;KKK K,5@<9$=XX`:f5x ,:::5<';<5*(KAKMzyo<m=~ l>uy  <J0MGMGL9MIKM[J%JK,uLMu  <pJQyJMxKJyJJQyJMxKJyJJ( sJBy<DN>MCQyJJ>QJ/JDv( J <rJ wKKKKKKOJ~4vy~5|,JJJ{JJJJiJ{JuJ'9KKL$JsJ{M <=xR(~(JsJ{$B$wNFNNLM?J$JzuK$~z}0(~}~({G8K~y|~<I<J J JJ P,D<J,uIK tJJ4(<JF(JND, 4zKKN,,K4O@, C1K( DJzJzJ >HJJ6JJ JtJ JtJ zIQ(  tStJ;u( wJiti( Jq< tJuKkJz0MGt(qJKIK, K_$#J=l仁KujJ = <lJgJIK~,$iJJO(Ab%JJJ(MHLdJaJkJMJlJIJkJJJ|O0K>4Bd} 1tR  KIIu0}<=t%JJPLJJzMIK>IKHcJ^tIq,J~<JJ<HKNEqJxJRLNEO MEMLFKLa=JB0MHLFKLJLHL>KIK  `<JJR|<"_J!JO,0QJ/JJ,LGKLFO"IN6=0XJ.JQJ/JP:bD,$,  $$$%  !8@@R! @!(@!0,`!`hB%ExB$FEeB$Ethx|d$t|d@' !  tW!8P@$ BFEDtE& !0 @t ! $  D t +@!t @ ! @ 1!8D  `$$$%t$4' $$ F4 !8'<'@'txp$$ !8@||$ 8<.0%b $8%x%(o8 ,$ $ !@z@8! @$ !8@!@| mb$$ !8@ !H@\C<<. & 1%8 $%pz%(<,L@ &! $ !8@ >I$$ !8@$ !@-N@<1 . %`E$8%x%  @x&uxp/$  @! @$ !8@ C@!pɁ p<'!'x4#(!d!!<<45043PL $J$n!l!C$4@!C$!e$1$|$!8%$ %$!!K$! $$! !(` !0@@$ $@ $C$$*h!No($!0!  $$|$!!  $}J$ ! C$!|$$BF GDBFG D$(,l@ $i$ XLpX9^p-Z TK npa4{j K ~D0z  K  EF04G,`H @K2DK4N PK P <(KQp d K2Q4. pKLS H 8KdTt` ,pKz4hv PK!kT `K#$mp L @K%t  K'~d T K) D 0K+T t  K-1- K/Z,$V  K1wP0@ K4ȃ؃pt DK;%dt! DK=3p؈)/ 3K?BpD> CKAVp2R CKCipʲXe 4D KEwp0" 0/oAQ LZ    &@41<0G,Whqx4T- +/$1!!#T#%p%/3' '6) d)+- 7,899D:/1346789:;=?ACEGPUZ_dxjp$u0z8PXTHI0 p %-3t?FU\cnu~ ",7AKT[al|bionic/libc/netbsd/net/getaddrinfo.cai_errlist_get_scope_get_label_get_precedence_rfc3484_compareget_portget_aiexplore_numericafdl_test_connectexploredefault_dns_filesdtab.5067res_queryNres_querydomainNgetanswerAskedForGot_dns_getaddrinfoCSWTCH.162_files_getaddrinfoin6_addranyin6_loopbackin_addranyin_loopback$LC1$LC0$LC2$LC3$LC10$LC11$LC4$LC5$LC6$LC7$LC9$LC8$LC12$LC13$LC14$LC15$LC17$LC16gai_strerror_gp_disp__errnogetservbynamestrtoulmallocmemsetmemcpyfreeaddrinfofreeinet_ptonstrdupsocketconnectclosegetaddrinfostrchrif_nametoindexgetenvstrcmpnsdispatchgetpidsnprintf__system_property_getstrcspnstrlensetsockoptstrlcpyfdopenfprintffputcfflushfclosefreadcalloc__res_nmkquery__res_nopt__res_nsend__get_h_errnostrncpydn_expand__res_hnok_getshort__p_class__p_typesyslogabortstrcasecmp__res_get_state__hostalias__res_put_stateqsortgetsocknamefopenfgetsstrpbrkZ  @ `b @i`"$&), CCC!B%1C>CECLCSCXCeCjCwC~CCCCCCCCCCCCCCCCC%C0C;CFCQC\ChCvCCCCCCCCC CCCC!C'C-C3C9C?CECKCRCYC`CgCoC{CCCCCCCCC9CECTC`CnC|CCCCCCCCCCCCC CCCC$C*C1C=CCCICOCUC[CaCgCmCsCyCCCCCCCCCCCCCCCCCCCCCC CCCC"C(C.C4C:C@CFCLCRCXC^CdCjCpCvC|CCCCCCCCCCCCCCCCCCCCC CCCC%C,C}CCCCCC#C5C@CLCZChCvCCCCCCCCCCCC"C0C>CLCgCrC}CCCCCC C C C- C; CI CW C C C C Ci Ct C C C C C C C C C CW C] Cc Ci Co Cv C C C C) C7 CN C\ Cj C C C C C C C C' CB CP C^ Cm C C C C C C C C C CCCCCCCCC"C1C<CHCiCCCCCCCCCCC CC'CiCtCCCCCCCCCC C0CCCCCC CBCxCCCCCCC CCCOC[CjCCCCCCCC CC8CDC\CtCCCCCCCC C3C@CICZCwCCCCCCCC CC!C-C:CYCgCCCCCCCCCC*C6CBCNCfCrC~CCCCCC  C?C  C ?  C2?7B<CG?N R WCqC}  C?BCCC?CC?C? C+?FCQ?VCa?fCrC}?C?CC?CCC?CCC?C ?C?C)?.27CCCOC[CkoBB?B??BB?B??CC'+/?B?GCR?WCb?gCr??C?CBB??C???C?;CBFJ?]?bCm?sC??C?C??C??CC?C/C6BKOBjnBBC??C?C???C!?'C9CECQCiCCCCCCCCCCCC*C;CMC_CmCC?C?C?C??C ? C) ?_ ?k p Cw | C     B B ? ? ? ?!!B+!BA!E!B\!Bo!?x!!!!!!!B!B!?!?!!""""&"?"C"Bc"Bl"?u"?"?"?"?""?"""?"B"?"?#?# ##?###0#?6#:#G#?M#Q#Z#?g#k#B#B#?#?##5##B#C#C#"#"#?$C $?$C$?,$?L$?Z$?h$?m$C~$C$B$C$C$C$?$C$?$"$"$C$?$C$$$$$?%C%?%C %?%%C0%?@%?E%CU%C`%?n%?~%C%&%&%?%C%?%C%?%C%?%C%?%C&?&&?+&CQ&?_&?o&?~&?&C&C&C&?&C&C&C&?&C&C'C'&'&'C)'?/'BN'&R'Br'&v'&'&'&'&'&'&'&'C () ()(?$(?)(C4(?C(?R(?c(Co(Cz(?(?(C(?(?(B(C(?(C)? )) )B)BC))G)BO)B)))B)B)?)?)?)?*B *?*)*B&*B/*?8*?A*?O*)T*B]*?f*)j*B|*B*?*?*C*,*,*?*?*C*?*?*C*?+C,+?:+??+CJ+?S+,W+Bm+,q+B+B+?+?+?+,+,+B,,,,%,CA,Cm,Cy,;,C,<,C,9,C,:,C,/,C-.!-C--4G-CS-7m-Cz-6-C-C-C-C-C  8 ,`y[d "* $s &K ),[[ 77[[  @ H  [[ \ ]T ^p \ EE DD[[, _t ` a[[( cD c[[8 @/ d\ bD  e$ /(/ /0/[[, fT gt \ h \[[ bt   . ..   /(/| f h $ /,/d j e @ c \ ^ \  c$ cL c  k$ k0 \x lt FF m GG .. \ h |   b / / n 4 4 5$ 5 H( H I0 I oD p@ JH Jd q r K s r K K s fP t| ` u L L g \4 h b / /  4 .<. v MM( w$ NPNt x y z b` OhOl { {T | { {< {| { _$ {[[ }@ ~D   L  h [[< sP sx pt PP "" s 8 [[  L sX  s$ L          QQ e d p  s / / d h e  66  ( sT u ( /8/[[H _ _ cL c\   \ X    c c, c $$ \ x  "" &&( c8 ch _ T  d ct  f g \ hX f| \  h h $ $H |   \ x $ $ 8 8[[p d RtRh S|S TT UU D t    iL e   RR SS  zP b  H\9:,;0<, )  $(,048<= $=( 4=8 D=HT=X==== =$H=L|="=$=&=)D=H, ( 8 HX$L"$&)H,     " ) - < @ G K Z ^ e i x |    #*.59@DKOVZim| (,37>BQU\`gkrv )-48?CRV]ahlsw$(/3:>EIPT[_fjqu &*15DHOSZ^mqx| #'6:BFVZaetx "&-18<CGNRaelpw{ !%48?CJNUY`dsw~    $ ( / 3 B F M Q X \ k o v z                        ! ( , 3 7 > B I M \ ` g k r v }                              " & - 1 8 < C G N R Y ] l p w {                           " & / 3 ; ? H L T X a e m q z ~                            $ + / 6 : A E L P W [ b f m q x |                       %)04;?FJQU\`gkrv} "&-18<CGNRY]dhosz~  '+26=AHLSW^bimtx &*15<@OSZ^eipt{ #'.29=DHOSZ^eix|  !%-1AELP_cjnuy  $-1:>GKRVgkrv}  "&/3CGOS[_gksw #,0AELPW[bfmqx|"&59@DKO^bkox|!"%"-"1";"?"Q"U"\"`"g"k"r"v"}""""""""""""""""""""""""!"%","0"7";"B"F"M"Q"X"\"c"g"n"r"y"}"""""""""""""""""""""""" """#"'"."2"9"="L"P"W"["b"f"m"q"x"|"""$$$$$$$$$$$$$$$$ $ $$$$#$*$.$=$A$H$L$S$W$f$j$q$u$|$$$$$$$$$$&&&&&&&&&&&&&&$&(&/&3&B&F&M&Q&`&d&k&o&&&&&&&&&&&&&&&&&&&&&&&&&&&&&,&0&7&;&B&F&M&Q&X&\&c&g&n&r&y&}&&&&&&&&&&&&&&&&&&&&&&& &&&&#&'&.&2&9&=&D&H&O&S&Z&^&e&i&p&t&&&&&&&&&&&&&&&&&&&&&&&&&&&&&%&)&0&4&;&?&F&J&Q&U&\&`&g&k&r&v&}&&&&&&&&&&&&&&&&&&&&&& & & & & & &/ &3 &: &> &M )Q )Y )] )n )r )y )} ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) )!) !)!)!)!) !)$!)3!)7!)>!)B!)I!)M!)T!)X!)_!)c!)j!)n!)u!)y!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)!)")") ")")")#")*").")5")9")@")D")K")O")V")Z")a")e")l")p")w"){")")")")")")")")")")")")")")")")")")")")")")")#)#)#)#)!#)%#),#)0#)7#);#)B#)F#)M#)Q#)`#)d#)k#)o#)v#)z#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)$) $)$)$)!$)($),$)3$)7$)>$)B$)I$)M$)T$)X$)_$)c$)j$)n$)u$)y$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)%) %) %)%)%)%)#%)*%).%)5%)9%)@%)D%)K%)O%)V%)Z%)i%)m%)t%)x%)%)%)%)%)%)%)%)%)%)%)%)%)%)%)%)%)%)%)%)%)&) &)&)&)#&)'&).&)2&)9&)=&)D&)H&)O&)S&)Z&)^&)m&)q&)y&)}&)&)&)&)&)&,&,&,&,&,&,&,&,&,&,&,',',',',',.',2',9',=',L',P',W',[',b',f',m',q',x',|',',',',',',',',',',',',',',',',',',',',',(,(, (,(,(,(,*(,.(,5(,9(,@(,D(,K(,O(,V(,Z(,a(,e(,l(,p(,w(,{(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,),),   (08@HPX`h"p$x&),       $ 048<HLPT`dhlpt (,04@DHLX\`dhlptx|  $(,048<@DPTX\`dhlpt  $048<@DPTX\`dhlptx|""""""""""" "&& &$&(&,&8&<&@&D&P)T)X)\)`)d)h)l)p)t)x)|)))))))))))))))))))))))))) ))) )$)(),)0)4)@)D)H)L)P)T)`)d)h)l)x)|)))))))))))))))))))))))))))))) ))))) )$)(),)0)4)@,D,H,L,P,T,X,\,h,l,p,t,x,|,,,,,,,,,,,,,,,        $(","0$4$8&<&@)D)H,L,getnameinfo.o/ 1331265336 1002 1002 100644 21732 ` ELF1P4(%"?8 % RU$ > : ; I$ >  $ >  I : ;  : ; I8 I !I/  : ;  : ; I : ; ( !I/ : ; I8 ' II&I&I : ; .: ;' I : ;I: ;I4: ;I4: ;I .: ; ' I : ; I: ; I 4: ; I!4: ; I" : ; # $&%.: ;' I@&: ;I': ;I(: ;I )4: ;I*4: ;I + U,1RUX Y-1.41/ 0411 : ;2&I3.? : ; ' I@4: ; I5: ; I61RUX Y 741 8 19 : U;1RUX Y< 1=4: ; I >4: ; I ?4: ; I? < Y int7;Nn2b94;LT; 5i Iob%;eCPtIubWy !b ] i $)# H %]# m u G)} -  .#   )#  b# L x# k # I       " y 2 "  2  B  ]  #   b# B # [ #  B#  !#^Z5/' I: TW  U# - VW#  W)# s X)# | YW#  d b e# y fW# & g)# G h# NW X# HY)#Tw_px#_ry)#_wz)# {P# +|P#_bf}# f~)# # # (#$ H#( s#, i#0_up#8_ur)#< y#@ /#C_lb#D ()#L S#P))()H).)hh)nN I  I 4  n )# #  kafdNG OO)# Pm# Qm# R)# 1]~ ^# _# `#)sa6buf^0!)q;a6n)p]B)hpm) )!one  =h l W)   "!buf 1h >Ȫ#!_rc) ri$)    [ ) -%l)( &sa!'hk''@m(!))0*( {+*y)O)F,~(----+H.../0o 9 ") sa m@ma3m!)!afd !sp !hp  )!i) h!v4a ( ( 1 # !'W#, r1i#> <#^ [0e)UyzC})) 2afd]3 ) 4sas5 sm5sy5@s05as 53s05!s)`69 lhx- - -u -j -_ -T -J +. 0 0 0 O. 0 0 0 -7 o7 s8 9< .C : 7_ m7k w0w ; P} -2-'-=-+0H0SM7^n0i0t7m7m<7m009.9< 0/x0/. :P .1 +x0 =7.=[/ , >S=  ?;?;"X bionic/libc/netbsd/net/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetbionic/libc/privategetnameinfo.cstddef.h_types.hstdint.hposix_types.htypes.htypes.htypes.hsocket.hsocket.hin.hin6.hnetdb.hstdio.hun.hin.hunistd.harpa_nameser.h 0IKzJk$>2s<uM?IHKNIKf9Q+<=<~J0~~J,M 0%< $A+LH$k%ik~~J~JJ~JB ( }~t0xu$KKvt$uu(N<JFt~<((%utcpudpANDROID_DNS_MODElocalnet.dns1.%d/dev/socket/dnsproxydr+gethostbyaddr %s %d %d<'!'40,($ !!!' $!0  $G@ ! U$!@+ @$40,($ 8'!( !  !0G#C$<d$J $'I $'%!  $@G,!0@!O&+$!( ! !! %$q@4!0,($ 8' $ M1'! !( @ ! @@!0@ H1'G<'!p' | x t p l h $!!! C $D $$ | x t p l h  ' $|F!C%Dc$d&$9(%!ˎ  $ | x t p l h  '"` ׎ @"2o@%2%pX'%1!  $ ! D$+D`$! `!( !0@$;R $#S!)2^ !*2@$Ď $~X'!(!0 $@ ! W$+ ! !( !0!4@$ &X <C`< Cd16& <b1f . J%PB %8I1%$ C<n.6 % ! @^;YG8(6 16%I$X'$ (d%ގ ӎ,@! @ %%@ŎƎ ! @Q!  d V$+ld ! !0! !(!8&  260;g S <'!8@%! @  $! @ '@$$ !0@!@$ '! @4 $'! ` !( n$$%' l$ F$H` ! @ n$$D>@! @ $@!@! `!(\' .$@e&!0@!8 ! @ @! !(@$^ ! @@$ ! @k`p`('22Q@ $Ďw!(!0 !8@ $ ! @V$'$$ !8@$H!@!$v~M0%(b Z%Hj1%(*$($ !8@S$  | (P\0Ph   | (P\0@Ph   @T@bTbPhbxb XUU @V@dV`dxd PWP`W$`Pp`x`ptR@cPdccR RHRRRR `T``T` T `D`` dUUDUU$8UH\UU,U `V`dVd dd `W`eWe W e ``pcp c   cc$c$88HcH ``pbpb  bbb$b$@@HbH ``papa  a(a(LLaa@lRp|R$RHHRR R$Rpxn$Xnnnnn$8n@pn n,4nlffp|gg$g<LgHg,g RDDRR8@RHHRP`R Rpcc<LcHPcc4cpxccpbb<LbbbR\bb4Hbp  <L HP d , R,8Rpbb<Lbb\dbd|R|bHbRRp$$<L$HP$$4$px$|m$R<XR4@RRpxR|Rp[ [DL[[8@[HT[ [] getnameinfo$TXPlp lp <L,PPX4,phl\dPX4,phl\dL,$Pproxy_addrgetnameinfosin6_addr__swap16gen_xns_s_nssize_tname_lens_protozonelenu_int32_tserv_lbfsize__u16socklen_tnumaddra_socklenns_s_qdlong long intsigned charaddrFamilylong unsigned intlong long unsigned intsun_path_cookielong intnumaddrlen_flags__be32_ubufservent_blksizesockinethostentsin6_portdouble_offsetin6addr_loopbackproxy__swap32gen_xbionic/libc/netbsd/net/getnameinfo.coff_tsun_family__uint32_tu6_addr8sockin6_uns_s_anport_readns_s_arpropnamefpos_thosts_addrsalen_close__u8h_name__u32_fileaddrStrshort unsigned intsin_addrandroid_proxy_hostent__padifindexs_aliasesh_addrtypeandroid_proxy_bufip6_sa2strsi_portandroid_gethostbyaddr_proxysockaddr_un_writesi_familysin_familyGNU C 4.4.3a_offsi_lensin6_familyu6_addr16s_porth_aliasesin6addr_anyhostnamelena_affloatns_s_zns_namesa_familyh_lengthh_addr_listsin6_scope_idaddrunsigned char__ns_sectshort intu_short__sbufaddrLen__sFILE__page_sizeerrorFILEexitsin6in6_addrafdluint32_tzonebuf_seekgetnameinfo_inetservlencharhostlen_sizeunsigned intsin6_flowinfo_ext__uint16_tu6_addr32ns_s_max__kernel_off_tpropvaluesin_portnumservfamily__page_shifta_addrlensa_family_tfoundsockaddr_in6sockaddrsockaddr_in_base/u/raghu/ics_feb29flagsns_s_ud_nbufns_s_prcache_modesa_datau_charresultbufsiz__be16ip6_parsenumericin_addrGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.ip6_parsenumeric.rel.text.getnameinfo.rodata.afdl.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 |<#>Lp^p] Z <8# np&j C# z2$h C`#p 4D#<0plp F #p 4F#pLU  DF #p(" $R# p((  ,R# p( DR#.p0*900Bo*0:0RT7$# $;U   &70< A F K P U( Z4 _L dP  !ir|&,3;AHObionic/libc/netbsd/net/getnameinfo.cip6_parsenumericafdl$LC0$LC1$LC2$LC3$LC4$LC5$LC6$LC7$LC8_gp_dispinet_ntopstrlenstrlcpysnprintfmemcpyif_indextonamegetnameinfogetservbyportgetenvstrcmpgethostbyaddrgetpid__system_property_getsocketsetsockoptmemsetconnect__errnoclosefdopenfprintffputcfflushfclosefread * !%1>ELSXejw~ *5AOnyCO^jx-;I^jx 4BP^lz+9HTbp (3>I_ju*6 : >QVafqv      : U ` k v           2 D Q ` l x                  ) 2  6 ` n w             ( 1 C L u ~              - 9 C P e  ##@ $` % & ' , ( ) % )##  L 'H Xp % & $ %0 &   + DT ,P h -  . % &  , /D '@ H` 0t 1 2 3 &  48 5@ 6H 7D Td $ 8  9 : ; $4 6H < < @D  D     ! % , 0 7 ; B F M Q X \ k o v z                          ! ( , 3 7 F J Q U \ ` o s z ~                         $ ( / 3 : > E I P T [ _ f j y }                           $ ( 0 4 ; ? G K R V ^ b i m u y                            " * . 5 9 A E L P ` d l p w {                           & * 1 5 < @ O S Z ^ e i p t {                            - 1 8 < C G N R Y ] d h o s                             $ ( / 3 : > M Q Y ] e i q u }                          & * 9 = E I Q U ] a i m u y                             !  %  ,  0  7  ;  B  F            ( , 0 4 8 < H L P T X \ h l p t x |                                  $ ( , 0 4 8 < @ D P T X \ ` d h l x |       getservbyname.o/1331265337 1002 1002 100644 6448 ` ELF P4(!<0% RU$ > $ > : ; I $ >  I : ;  : ; I8 : ; I8 ' I I &II!I/  : ; !I/.? : ; ' I@: ; I4: ; I4: ; I >GintXB40J!5S1 lCyT @U# {V# UW)# X)# Y#dd e# pf# tg)# h# NW jX# &Y)#>Tw _px# _ry)# _wz)# {E# +|E# _bf}o# 5~)# z# # #$ #( m;#, ,o#0 _up#8 _ur)#< dA#@ ZQ#C _lbo#D )#L d#P )  ) ) d d ) )0 0 )6 >Q>a\! # `#  # 1#B A#B )#B 60#B #B #B# "1AaRl1"0 "0Irs$Grs%Xs.c! bionic/libc/netbsd/netbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/privategetservbyname.c_types.hstdint.hposix_types.htypes.hnetdb.hstdio.hresolv_static.h"(IKLyrrJ<'!',($ ! ! @!@`@4!@ ! !(@ @!@ D@  !(`@,!($ 0' !,$C(!$ 0' |  P0T |  P0T0 8T8bb 8U8cc<DaDXRXaRaXx`xR`` Xgetservbynames_protoh_addr_ptrsu_int32_tlong long unsigned int_lbfsizeGNU C 4.4.3long long intsigned char_ubuf_bases_aliases_cookielong int_flagsservent_blksizehostentdouble_offsethostfoff_t__uint32_tres_static_readfpos_thoststayopenunsigned intgetservbyname_closelong unsigned int_filenameservent_ptrshort unsigned inth_addrtypehost_aliases_writes_porth_aliasesfloats_nameh_lengthh_addr_listbionic/libc/netbsd/net/getservbyname.cunsigned charhostbufshort int__sbuf__sFILEFILEprotouint32_t_seekhost_addrchar_size_ext__kernel_off_th_name/u/raghu/ics_feb29_nbufGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.getservbyname.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 0>xLpx^pZ 8` npPgj  ~z @ p4 4 p  p $ p  p=  p0M `0  o    l   ( 6?PXebionic/libc/netbsd/net/getservbyname.cgetservbyname_gp_disp__res_get_static__errnogetservent_rstrcmp !%3:AHOTahov}  ,:HVep| &4BPzbmzHZe i m v      . ( H X l           $ + / 6 : I M T X _ c r v }                   getservent.o/ 1331265337 1002 1002 100644 16004 ` ELFT.P4((%? ?8 % RU$ > $ > : ; I $ >  I : ;  : ; I8 : ; I8 ' I I &II!I/  : ; !I/.? : ; ' @ .? : ; ' @: ; I4: ; I .? : ; ' I@4: ; I4: ; I4: ; I U  U4: ; I RL8intl T2Wp40^24D+5^w wC(yT$ U# V$# W)# X)# Y$#do e# f$# g)# h# NW ~X# IY)#>Tw _px# _ry)# _wz)# {E# F|E# _bf}z# I~)# # -# #$ 4#( F#, Oz#0 _up#8 _ur)#< xL#@ \#C _lbz#D )#L o#P )  ) ) o o ) ); ; )A !>\>l&\!   # # +# :<#B L#B )#B ;#B *#B #B#+"<Ll]w<f$) rs&RRj33rs3RSp5;q6;7)nn8)8)9):)p2; TL)3 qfLF k)d*_Lwrs|R#  , bionic/libc/netbsd/netbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/privategetservent.c_types.hstdint.hposix_types.htypes.hnetdb.hstdio.hresolv_static.hservices.h-$uL 3 0K7JJ6JHIKQMMKILHMGPFNyLOKIIKQ$JMIKKIFMMHFOENFOGMpuKI <'!' @4!@ 'udptcp<'!'40,($ 4! !2@C&4!0,($ 8'$1&C&!#uS&& !(c$!gB$$*0U!d!( Lpz^pRZ 7@& np3j : & z4 < < :&2x   ;X&p L d; & pd&| ;@&&| ; &p\'  ;&p)P =&3pl)8/ =(&Fp)`B =& Tp0*_0,ho,,x4P' 6   % "/4#$9 D<OXiv~Lbionic/libc/netbsd/net/getservent.c_services$LC0$LC1endserventsetservent_gp_disp__res_get_staticgetservent_rreallocmemcpygetservent @!`$ !%3:AHMZ_lsz+7ESap{#1?M[mxSel p y     #7<EOU Y blrw9 I ]  p x " #< @d #  0 ! $( <@ hl ( @ l     $ 3 7 ? C S W ^ b i m t x                        $ 3 7 F J Q U d h w{   (       $ ( , 8 < @ D H L PTbase64.o/ 1331265337 1002 1002 100644 10912 ` ELFP4($!@% RU$ > : ; I$ > $ >  I : ;  : ; I I !I/  : ;  : ; I8  : ; ( &I.? : ; ' I : ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I4: ; I4: ; I1RUX Y 11X Y1X Y4: ; I &I 4: ; I !4: ; I? < Oint;o?2iIW&;+tI$   $  4  O I#  ^,ZR)c)42)Osrc 0>bQ}0oo0Ox_i0 _  o 3)p>srcؗb٢X}00)ch)posޒN\ >'/  .Z 4 /Z  @E G=!z8!9P!: bionic/libc/netbsd/netbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetbionic/libc/privatebase64.cresolv.hctype.hstddef.htypes.htypes.htypes.hin6.hin.harpa_nameser.h <xJeJHKKKGKKKJJKJp JNHmJJIHKG%JIJ~J wLQIKIKILHKK$A6<nJ JQvJKJJQuJJ5<JK0+_ JwMk  JU$JXvK -JJ,KPFpKIKILHLHLN#~<J<?~<J~ <'!',`@!%$a !h?x1!X!Ȩ/L8iolxi$c$1Y !Px$+`-3H,B$h !H(!PH$'B$.' !Henc$i$D$+ `  1Q y!`Oc$p!h!!X $yoH$0`i !!$!@B$!= $jB$+8G!0'!!H=$%B$<'!'<840,($ !H!1&!!=$$ $!0EĐ0`&!`!`U<!`<840,($ @'< ! A@ *$ R@c&$!`@c&!!`8@c&$!`@!`$!`H+@i!PS%#XL B!`$H+`!S$#(Q%0&c&!&$G*0$!`<$840,($ @'H+@i!`S'#hTp %X !PC$BH+po!S$d#0E%$!C$( $0!X1<dc$!(D0<$$0!8H>2 = $d!XDjI1 c$= $<dc$U@!`!SB@!`P<ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ | P0pP@h   | P0(pP@h   TT U VV WWRDRDhXpRRXRp pTp`S`$S$`pS PUPbb$\b pVp44ddttp\cS c ,S,4c4@S@HcHTSThchpSpcSc$S$(c(dSdhchSpcXhdhndndndn@d@LnLdndn d$\n\dndnPdPpnTT$hThT X PTPphptRRRRRR$PRdR,__b64_ntopo__b64_pton$p\`ptp__u16__ns_sectsize_tstatetarindex__u32ns_s_qd__b64_ntopshort unsigned intisspacens_s_udtargetfloatunsigned chartargsizeinputu6_addr16long unsigned intu6_addr32u_charns_s_pru6_addr8__be16srclength_tolower_tab_doublein6addr_loopback__b64_ptonin6addr_anyPad64unsigned int__be32long long unsigned intin6_ubionic/libc/netbsd/net/base64.cdatalength_ctype_long long int__u8GNU C 4.4.3charns_s_anns_s_arshort intoutputlong intns_s_ns/u/raghu/ics_feb29signed char_toupper_tab_ns_s_znin6_addrns_s_maxBase64GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__b64_ntop.rel.text.__b64_pton.rodata.Base64.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 ">Lp^p\Z " np@j P#" ~ z `#0"  p #p" DpPX $ "X $"p 0$"p0 @*"p( H*" p0 `*@"p06&%0\.on~>\# < \   !A ( 3<pGOVbionic/libc/netbsd/net/base64.cBase64__b64_ntop_gp_disp__b64_pton_ctype_strchrabort  !%1>ELSZahov}5AP\bhntz   (-;q|     , 0 ?[d  x  $   D P \    X |  0 8 p x   ( ,  ,      $ + / > B Q U \ ` o s z ~                         $ ( / 3 : > E I X \ c g n r y }                         & * 1 5 < @ G K R V ] a h l s w ~                             $ + / 6 : A E L P W [ b f m q x |                             % ) 0 4 ; ? N R Y ] d h o s z ~                $ getservbyport.o/1331265337 1002 1002 100644 6424 ` ELF P4(!<0% RU$ > $ > : ; I $ >  I : ;  : ; I8 : ; I8 ' I I &II!I/  : ; !I/.? : ; ' I@: ; I4: ; I4: ; I >GintX=40J!5S1 lCyT @U# {V# UW)# X)# Y#dd e# pf# tg)# h# NW jX# &Y)#>Tw _px# _ry)# _wz)# {E# +|E# _bf}o# 5~)# z# # #$ #( m;#, ,o#0 _up#8 _ur)#< dA#@ ZQ#C _lbo#D )#L d#P )  ) ) d d ) )0 0 )6 >Q>a\! # `#  # 1#B A#B )#B 10#B #B #B# "1AaRlP!) !0Irs#Grs$Ps-]! bionic/libc/netbsd/netbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/privategetservbyport.c_types.hstdint.hposix_types.htypes.hnetdb.hstdio.hresolv_static.h!(IKLyrrJ<'!',($ ! !@!@`4!@ !  @!@BR  !(`@,!($ 0' !,$C(!$ 0' |  P0T |  P0T0 8T8bb 8U8cc<DaDPRPaRaPh`hlRl`` Xgetservbyports_protoh_addr_ptrsu_int32_tlong long unsigned int_lbfsizeGNU C 4.4.3long long intsigned char_ubuf_bases_aliases_cookielong int_flagsservent_blksizehostentdouble_offsetgetservbyporthostfoff_t__uint32_tres_static_readfpos_thoststayopenunsigned int_closelong unsigned int_fileservent_ptrshort unsigned intporth_addrtypehost_aliases_writes_porth_aliasesfloats_nameh_lengthh_addr_listunsigned charhostbufshort int__sbuf__sFILEFILEprotobionic/libc/netbsd/net/getservbyport.cuint32_t_seekhost_addrchar_size_ext__kernel_off_th_name/u/raghu/ics_feb29_nbufGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.getservbyport.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ ` npPaj  ~z @ p4 4 p p $ p  p%  p05 `0  o    l   ( 6?PXebionic/libc/netbsd/net/getservbyport.cgetservbyport_gp_disp__res_get_static__errnogetservent_rstrcmp !%3:AHOTahov}  ,:HVep| &4BPzbmzHZe i m v      . ( H P p t          $ + / 6 : I M T X _ c r v }                   ns_name.o/ 1331265337 1002 1002 100644 37776 ` ELFUP4(52h  PP8`8% RU$ > : ; I$ > $ >  I : ;  : ; I I !I/  : ;  : ; I8  : ; ( &I.: ;' I : ;I.? : ; ' I : ; I: ;I4: ;I : ;4: ;I .? : ;' @ : ;I : ;I .? : ; ' I@: ; I: ; I4: ; I 4: ; I!4: ; I" : ;#1RUX Y $1% U&41'41( 1) *.? : ;' I@+: ;I,: ;I-4: ;I.1RUX Y/4: ;I01RUX Y 1124: ;I 34: ;I 4 U51RUX Y64: ; I 7&I84: ; I 94: ; I? < IHint\;#R^W IW;UtI;v;)6/   /  ?  cZ d#  ^Q @h3`I  )ch)) c)u)%c))msgdncpspcppn=)c)pM)bpMendMBMdstNeomNP)cpQtpRcS9TUV)#V)\V)pV)I)I)AcppAdneomcpbeg tc b!)p!)Y!)i!)A)ech))ch)ndsrcnTnUoV{)srcΨ!dstιG0jй bpй eomй c) n)) e)1!cpҒ"4t#T$$$$$%@&O'''2'='G&S&_&ks'w&()'0)KlpJ)l*qR)d+srcR+dstR ,R0)-cpT<-dnU-eomU-cVnW-lX)8.4i$)%&4'@*H),+eom-cp n-l)0 .<$)%&4d '@*) +msg +eom +src +dst` 0/ /} / -n); -len)d /B) -l) .$)%&4 '@g)h srcg dstgh g0 cpi dnj; eomjd ck nl lm)c00u $)%H&4'@%` m)O#$1x$%''' &'&*'6*C)*i +msgCK+eomC^+srcCq+dstDD02tmpFi }-nG) y *l)x{ +src+dst+,)u,/V-cpp2lpp -eobX-msg/-n)m-l)3),"1l4 -l0).$)% &4'@5%HP $[$O$C$7%'g&r'}'&X(54 1v.1.|'$)%(&4 '@*_)I +src_j+dst_},_0,``2tmpbi }6. 7c?6/  J 88[ : 8:q 9899  P9:  bionic/libc/netbsd/nameserbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/include/netinetbionic/libc/privatens_name.cctype.hstddef.htypes.htypes.htypes.hin6.hin.harpa_nameser.hE>K<J_JQKzJ!JdJ1JMSJJzJ$zytPzJzzJPK+K,L yJ_K'J$J{JJJJJ(=M0:LzJxJJt>gJqJ?#Jz$KwzHKKN < {MGMKzJJ{rB2*^@ $kKU&!+4!(` F&"@!u! ?0Z%(t!(ǐp($+S $ %$#!$#\XTPLHD@<8`' \a $LX$TPLHD@<8`'! -! *! '!J \$DX$TPLHD@<8`'A$T$m h%x%%l `l%($<'!'40,( ' !!!( $$C H! !(@!0  40,(8'4$0,(8'0123456789   |  d0Phh  dP DP D0PPh  0hPPh   PT0xP`h   PP |  d0$Phh  XdP DpP D0PPh  0hPPh   PT0xP`h   HPP dTd|S|XXS<SPXpXUX,X,4S4dXdpTpUXU@TxUT@X@DTDTUTXTX XUXgggg V<XVVVTVTccc`clcP`S`S`H`HS`$SxS@`@TSTl`l`S`Lbb btbbtnUU<LnXhnhRn(S(lnSnSRn0RTSR,0^0LnndT<HTTT8@TTT``|V<XVVVVhVV8VxV@VLVV|hhxix|[<X[[[[`[4[x[[|Z<XZZZZ`Z0ZpZZZ|Y<XYYYY\YRY,YxYRY R YYRYd TTTT4dT UdU V<hThYTY$Y$,T,dY0xSxWSWSdSVdV<tZZZLZTXZ<@R\RR@RLTR\dR@LRT\R TT UUURRR`tS|SSSD\\ XTXaaa XUXdddUdd XVXd`dV`V` WlWtWlbUb4U4bUPZlZtZW^W lTtWTlTtTtccpeeeR`lRRRSSh TTT,8T@pT T lUl8W@WWhWWPW`hW pVlTggLgLpTpgThgh0`@h`ph`Tdapahal|RRR,8RRRlX0XXX8X@XXpXX,XHPX`hXlpVVV V,8VpV$V VHPV`hVl^,^^8^@^^,^ ^HP^`h^ln,Hn n,Hnn$n Hn,8SSW(PShpSS HS|RR``R DT DU DV <W<hataLdbtRbx T|TT`xT PUPd`lx`|`0`8x` @V TWTg(W(_ _,_W8_<l_ltWt|_|WgWg8T_T`W`xgT d T,Td8T8TdTlTltdt|T|d8`Tlag,Hgl|g|aaa,a8`g`xaa,`ala8`aTf,Lflff8xfSDcDV c VcV,Xcl|c|ScS8`c`xSRb,\bl|b|RbR8`b`xRHVH]]V ],]V]8]<l]ltVt|]|VV8H]HxVUpxU0\\l\,8\l\\8x\(U U,pUU,U<lUtUtWW(LhXh h,h8h<h8`hDo o,o8o<@olo8`o]l]H`] DT <U<xbb <V<|aa 0W __ns_name_rollback__ns_name_ptonK__ns_name_ntol__ns_name_skip__ns_name_unpack__ns_name_ntop __ns_name_uncompressy __ns_name_pack{ __ns_name_compress\ddhxTX@TlptTX@Tlpt4<4dXp4<4dXp<D<D  , hp, Hp, Hp`x `x`x , ,|8`,8|8`,8ddhxend_blenns_s_zndomainbionic/libc/netbsd/nameser/ns_name.cnextlabelptraillenshort intsize_tin6_addr__ns_name_pack__ns_name_ptonmklower_tolower_tab_valuedstsizptrptr__u32__ns_name_uncompressdn_find__ns_name_rollbackdecode_bitstringu6_addr8u_charfloatlong long intlong long unsigned intu6_addr32ns_s_an__ns_name_skiplong intns_s_arns_s_prencode_bitsring__ns_sect_toupper_tab_digitvaluedigitsns_s_maxafterslashin6addr_loopback/u/raghu/ics_feb29unsigned charcleanupdone__be32__ns_name_compresssigned charunsigned intlabellenbeg_blencheckedbitlenns_s_qdplenshort unsigned int__ns_name_ntol__ns_name_ntopcharlastdnptrns_s_udsrcp_ctype_isxdigitdstpdnptrsisupper__ns_name_unpack__u16printable__u8long unsigned intin6addr_anydoubleescapedcountu6_addr16ns_s_nsu_intspecialGNU C 4.4.3__be16tbcountin6_ulabelblentolowerdstlimfirstGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.ident.text.__ns_name_rollback.rel.text.__ns_name_pton.rel.text.__ns_name_ntol.rel.text.__ns_name_skip.rel.text.__ns_name_unpack.rodata.str1.4.rel.text.__ns_name_ntop.rel.text.__ns_name_uncompress.rel.text.__ns_name_pack.rel.text.__ns_name_compress.rodata.digits.rodata.digitvalue.rodata.CSWTCH.99.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 cH3>xLpx^pv Z Hc3 npj XkH3 z<dd k3 d l83x! Xl(3d" l032\$t$h l3,(( m 3Kp)xG mP3d-` n 3}. ./p0h n3#1h nH3%pT3 n3'p6K x3)pL` P3+ pcL Ѝ3-p0O#0S,oSS<,^4) a1   &  -!8" !"#%')+-/BGL Q01Vdixdhxbionic/libc/netbsd/nameser/ns_name.cdigitsdigitvalueCSWTCH.99$LC0$LC1$LC2$LC3__ns_name_rollback__ns_name_pton_gp_dispstrchr__errno_ctype_strtol__ns_name_ntol_tolower_tab___ns_name_skip__ns_name_unpackmemcpy__ns_name_ntopsprintf__ns_name_uncompress__ns_name_pack__ns_name_compress) *@0`235789    !%1 > E L S Z a h o v }             @ L [ g m s y        & 8 P \      H T ` l x      + H f           *9FSX bo~       5 M Y]au   &*.7 BRay   !& 16 AO_d o}     * 7 D M Q a j v              ' 7 <  d {              ! 1 6  A O ] b  q  x }              / 9 = I U Y f o }                 K  W a  m w      xh++@ \ , , ,x - . - - . - / ++$ .( 1P - -8 -++\ - - -++ - 4` - -++< X@ ` - - -, - - !( !! 6 "" -X 6L #d# 6 $$ -8 6, "D"++( 3t 5++ - - - - 4p -| - -++$ *X 8 $( X\ptHL ( \tL    ! % , 0 7 ; B F M Q X \ c g n r y }                              " ) - 4 8 G K R V ] a h l s w                           % ) 0 4 ; ? F J Q U \ ` g k r v }                            ' + 2 6 = A H L S W ^ b i m t x                            " 1 5 < @ O S Z ^ e i p t {                           " ) - 4 8 ? C J N U Y ` d s w ~                             $ + / 6 : A E L P W [ b f m q x |        )-<@GKRV]ahlsw~%)8<CGNRY]dhos     ! 0 4 ; ? F J Q U d h o s                         ! % , 0 7 ; B F M Q ` d k o v z                          ! ( , ; ? F J Q U d h o s                        " ) - 4 8 ? C J N U Y h l s w ~                           ! ( , ; ? F J Q U d h o s z ~                     $(/3:>EIPTcgnry} &*15<@OSZ^eix| *.6:KO^bqu +/6:AELPW[bfuy "&-18<CGVZaelpw{$(/3:>EIX\cgnry} #'.29=DHOSZ^mqx|%)04;?FJQU\`gkrv}$(/3:>EIX\cgvz  $+/6:IMUYjn}  (08@HP         $ ( , 0 4 @ D H L P T X \ ` d h l p t   $048<HLPT`dhlpt  $(,048<HLPTX\`dhlpt (,048<H L P T X\`dhlptx|ns_parse.o/ 1331265337 1002 1002 100644 13440 ` ELFP4()&088% RU$ > $ > : ; I$ >  : ;  : ; II !I/  : ;  : ; I8  : ;  (  : ; I8  I&I : ; !I/.: ; ' : ; I: ; I.? : ; ' I@ : ; I .? : ; ' I@: ; I: ; I4: ; I U4: ; I1X Y 1 1RUX Y ! " U# $4: ; I %&I&4: ; I?  ointc?q]2WR40o&D3L5^!>W0\t>e/?/ ? O  0j # ^     M   #gj 0n= Ko=# o=#_idp# Kp# ]pH# qX# Er#$ >s)#( t=#,CX =h u x x)# x)# :# +# h#ttl# # =#oCmsgCzȧhJ)DPJhJ)0O)ptrO= eomO=2OWO){P=bS)SS)%)!PC2)Frr!b)Ph7, (7, P7,!Tp9=!p9=!L9=h9=g) msgg=#Ug)PgCeomh=ii)*"9p=!9s=!9w= 47,#b})S$8 .&%0O$ /&s[ &7mK[ bionic/libc/netbsd/nameserbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetns_parse.c_types.hstdint.htypes.htypes.htypes.hin6.harpa_nameser.hin.hL (EGNtKntGGN HHLn<,F=zPIHJw"J M-JONJ KIK=HK J JKtJIKT0KK]2vJ`KI4KPGG(LIKt< JtJJ9KH HLKJKm$mJmJJGMt$K$NetBSD: ns_parse.c,v 1.2 2004/05/20 20:35:05 christos Exp $<'!0X !PIDC$  b<'!',($ !!8! !! ` !( D$!dc&&@+ #fb*%E!s+3 ,#r($ 0'! ` !( C$&A!c ,a$G($$ 0'!<'!'40,($ ,!!!@!$e$0!($,($eH@4&@`!X j*HJ (*pG*,! #8G !0 {A$40,($ 8'!x!8*$(,$ !8`@,!C$+(_,ONjK$%`, lJiB %8 g! ,`` `@(!D$* ('&$8$+&P !H ((,4!0,($ 8'( E$+-G$Xomjv%Xd %@lJ %0 ,fR%#C0!+ b,e,!,  $M$$(,!,(!0b, a$P}$<'!'40,($ !!$^^<^^4+(,## ##### #$#(#$F5J $%@*+8>(Mb% " $! ! &+x#% RB$! !$ 4`R&&Vs&4$$2(3, !0,($ 8' 4a$D0$,($ 8' a$P4$0,($ 8'! !0@ !(@p!x   @  |  D P0T$P8X(P8` |  D $P0T$HP8X(pP8`0 8T8@b@ccbTbcbb 8U8aUaa PVVVVV @W@`W `WT|RRRR8 DTDP`P\T\``` DUDPaPXUXaaaa DVDb$b bbb DWDccccR0R8DRR8 T`T`TP`PXTX`T`` LU DVDLaXaaa<<eXxeeeHbbb4RRRRRhsI__ns_msg_getflag__ns_skiprr__ns_parserr'__ns_initparse[_ns_flagdata4D@`d L\hlDrrnum__ns_skiprrns_s_zn__ns_msgns_secttypein6_addrt_cp_rrnum_sect_flags__uint32_t__uint16_trr_classshort intoptrin6addr_loopbackbionic/libc/netbsd/nameser/ns_parse.c__u32__ns_msg_getflagu_charfloatlong long intu6_addr32ns_s_anlong intshiftns_s_ar_msg_ptr__ns_sect__ns_parserrsectionnameunsigned charns_s_nsmsglen__be32signed charlong long unsigned int_ns_flagdatauint32_t_sectionsunsigned intns_s_pru6_addr8rdatans_s_qdshort unsigned int/u/raghu/ics_feb29charuint16_tns_s_ud_eom__ns_rr__u16__u8long unsigned intin6addr_anydouble_msghandlecount_countsu6_addr16setsectionsectrdlengthns_rrflagGNU C 4.4.3in6_uns_s_maxns_msgmask__be16__ns_initparseGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.ident.rel.text.__ns_msg_getflag.rel.text.__ns_skiprr.rel.text.__ns_parserr.rel.text.__ns_initparse.rodata._ns_flagdata.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 ' '>Lp^psZ 'p' npB j H, ' z =4 D h,'x  ,0'  ,8'x ,('lp -@'  P- 'p p-')pl% 03'=p89 83('PpRL `3 '!^p0i0ro$0(  '   !#$%'D8ANZhp}bionic/libc/netbsd/nameser/ns_parse.c__ns_msg_getflag_gp_disp_ns_flagdata__ns_skiprr__dn_skipname__errno__ns_parserrdn_expand__ns_initparse @ `" !%3:AHMZ_lsz P\kw}!/it 8KV Z ft    #-2<AKYfo s         )4 8 <OT^cm|         '0\ih }  D  @ p      !      $( HL pt  ( L t      $ + / 6 : A E L P W [ b f m q x |                          # * . 5 9 @ D S W ^ b i m t x                          ! ( , 3 7 F J Q U \ ` g k r v }                        # ' . 2 9 = D H O S Z ^ e i p t {                          * . 5 9 @ D S W ^ b i m t x      (         ( , 0 4 8 < @ D P T X \ h l p t             ns_ttl.o/ 1331265337 1002 1002 100644 8760 ` ELFhP4(%"h@% RU$ > : ; I$ > $ >  I&I.? : ; ' I  : ; I .: ; ' I@ : ; I : ; I 4: ; I 4: ; II!I/ .? : ; ' I@4: ; I4: ; I 1RUX Y 11RUX Y 4: ; I? < :0int;COo]=ws) c)) c) )U t)! s4 bufUR [{ tmpalen00q1%7)v src7 dst7g 708 9)59))9)[9)9)x9)p:+pchY)>]_\89P/: bionic/libc/netbsd/nameserbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/include/sysns_ttl.cctype.hstddef.htypes.h(N=KEOpKLGKLK68HLHKMGMGKyJQyJQLwJ J?G,w $r$m$: JJ:JGJ9 tHHJr,$ws$}$NetBSD: ns_ttl.c,v 1.2 2004/05/20 20:35:05 christos Exp $%d%c<'!'d`\XT!@'!!$!0!8 ! C$!@+ @d$`\XTh'D !( Id!03#F!`\XTh'<'!'<840,($  <5 <I5Bk$<%I5BI!HD# B!C!!$<%IC4#Bx!p(0##  <5KP @I8# '#DW<7xxBq1(#h#mV@ LpO^pZ # npj # z;2 0# p#p d X #, d x#p } 0#p & !#p3( !#p[H !`# p0^+04o#D0$ 0m   %* !/8@GW_bionic/libc/netbsd/nameser/ns_ttl.cfmt1$LC0_gp_dispsprintfstrcpy__ns_format_ttl_ctype__tolower_tab_  !%1>ELSZahov}   ',6s~  +0 4 BK Od hw, S 0 , @ |  0 @ h     ,   8<  <     ! % 4 8 ? C R V ] a h l {                           ! ( , 3 7 > B I M T X g k r v                         ' + 2 6 = A H L [ _ f j q u |                          + / > B I M T X _ c j n          $ 0 4 8 < ns_netint.o/ 1331265337 1002 1002 100644 5104 ` ELF P4($!% RU$ > $ > : ; I$ >  I&I.? : ; ' I@  : ; I 4: ; I : ; I .? : ; ' @  4: ; I.? : ; ' @ int>>o2WJ40Lz83L5^^t>v0w~yez$* src$T dst%,,a src, dst- "4 src4T dst4U  t_s55-9  src9T dst9U  t_l:: bionic/libc/netbsd/nameserbionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/include/sysns_netint.c_types.hstdint.htypes.h#+,3K8u$NetBSD: ns_netint.c,v 1.2 2004/05/20 20:19:00 christos Exp $%bN %@$%%C06 |   ,  |   $, 4 D TJ __ns_get16*__ns_get32a__ns_put16__ns_put324, , t_cp/u/raghu/ics_feb29u_int32_t__ns_put16__ns_put32floatunsigned charlong unsigned intu_charu_int16_t__uint16_tdoubleu_long__uint32_t__ns_get16__ns_get32unsigned intlong long unsigned intlong long intGNU C 4.4.3charshort intu_intuint16_tuint32_tlong intbionic/libc/netbsd/nameser/ns_netint.csigned charshort unsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.ident.text.__ns_get16.text.__ns_get32.text.__ns_put16.text.__ns_put32.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 ` ">Lp^p Z p" npj  " z> ,8L plP @"P P "p  p"pN " pm8 ("p( @",p0]70*@o<LP<#  T    (3,>I bionic/libc/netbsd/nameser/ns_netint.c__ns_get16__ns_get32__ns_put16__ns_put32 @` !%3:AHMZ_lsz  ,7 ; Qcj n            $( 48 DH  ( 8 H      (         ns_print.o/ 1331265337 1002 1002 100644 49080 ` ELFpP4(-*0P0H.@% RU$ > : ; I$ > $ >  I : ;  : ; I I !I/  : ;  : ; I8  : ; (  : ; I8 &I : ; !I/: ;I : ;.: ;' : ;I: ;I.: ;' I 4: ;I.? : ; ' I : ; I.1@11X Y1 .: ;' I@!: ;I": ;I#4: ;I$4: ;I % : ;&1RUX Y' U(41)1RUX Y*4: ;I+4: ;I , U-4: ;I..? : ; ' I@/: ; I0: ; I1: ; I 2: ; I 34: ; I 44: ; I54: ; I 64: ; I7 : ; 8 : ;91RUX Y : ; <4: ; I=4: ; I >&I?4: ; I? < gRint;>B2b4;N&!iR3W5iIeb3;(BtIv;4w Fp F^ V] f V  f  v    B # D ^o: g I0 nd  od# / od#_id p# / p#  po# - q# 4 r#$  s)#(  td#,j   d  u  R # 7 #  #ttl #  #  d# F   lw6 H  e ; g H[9 !D"#o$%<&'y()*_*iq -t =\ Gx dxn!lenn0bufnn!00^R|)zc)hu)srculenu0bufuu!z I}Lh{ B)X7!msgBd"B0!ppC "C4!bufDh"D!#F0#F0#G<$nH)$%f8%W[L&'|ME9e'0(Q)`c )(!len0"0")!buf"!<#0#*t))zPx{ % )$ " d0" d!buf " !!d#"0,+#%:P&zD%p{, -n()&z0Q {)z.$<{)zP(7{.r)`J/msgrdl0r0P0Rs40s{07sl1ttlt0td 2nt00Vu0u/bufv0v03x3yd4z)4N|5tmp}6len~),6x~)#7WD8%9'H^ E9'p(Q, *n)m*m)*p9$ ,4 +L-typ## #;:*t*n),h -n),  *n)#) &8 '`*c>:L l 6tr9(  9 ( 9 K )d :X -t , $av>)#%))P : -t:($tG",H'$tV3,`4II*algI*nJ)E*sizK;+L+LC#;M;-strW,0+L#5##;*n)g:<qd$tS,-n9)*c9):Dk__$t`S;`-tv w)-errw)Mw)  c "* 3 C S ' c 1.'\)0\/rr\0V]B0]k1buf^2^0v= /?U8?t9RXP?W:R+   bionic/libc/netbsd/nameserbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxbionic/libc/include/sysbionic/libc/privatebionic/libc/include/netinetns_print.cctype.hstddef.h_types.hstdint.htypes.htypes.htypes.hin6.harpa_nameser.hin.h IKIKw =K>IKJqJJqJJrJJItJQ0Lu<KK$LMpJlvKIKJ dPdJJiJJIQtt<KJJJvJKIKIKJL>JJ JJvJKIKIKJtvKIKIK JzJD zJ8r$J0xLzp0"J$KIzJJzJzJ@0Y(,TJ,JX v uLHLHMIKK$(({tIKI{򃻿,{qt{@ILIKIK=KIK4{IK~J{<<}uJ|JJ|JJ|JJI|JM=JEvJEzJIL󄼁>M=Mv<|4$($@=IKK=u$($IKK=KzJJKzJKzJ=$=IK{JJK{JK{J=$IKK=IKI{J@!P`ɓ+Inj$%FK`&!X+(F!D&!v &lKs&lH %$J 3ve ! @-GO%X$_, $S D$XO$@<840,($ H'!.ΓM#tQ>&&^ D@<840,($ H'<'!xѽ'..|.x.t.p.l.h.d.`.!...!!...P.@H.!( ! @$WE"! $\$.$ @=!  !('R5@#(>;.'%.'! !(!0@!8`!Ȁ \.@\.!5@. $!5_.$! `$$!0@!Ȁ !8`A$..|.x.t.p.l.h.d.`..'ST&&&.'.'d%T%$!0@!Ȁ !8`@!@... X.@!H@..!0B#.T.. .!  \.0'\.$!8@ ! ! !(@!0@!8`!Ȁ \.\.X.@T.! i!0$!8@9% @H.. $!`aH.. $ .$.! .$$!8$$.'H..`#0%%!  !(@! !0@!Ȁ !8`s@2'.&L.H.+H.Ŗ#h*$ L. !.h$!PF \.\.!*p! @%%#! !(!0@!Ȁ !8`F@*$$!0@y% !8`9@'0$!0!8@' /@-%̐L.!$!c$xx .$!Hc?3@&&B$$*P .#(! !0@!Ȁ !8` @.!@.+05##M! `!5O! `$!0!8@y$ @!@@&&.'4%.'.'.'D$&$.P.# $.&$ $\.$5.$>..]. ..%.%%.! .T. \..\.$! @. \.\.T.$!0@!  !(@! !0@!Ȁ !8`@ ! +V|@.H.#0'%....$ . ! .!#"..P.s#!8 $..."%... $. ! ..#Hb$!"...' ! !(@! !0@!Ȁ !8`D@.%.%%!!H.+$%.2! !8`!0@ $!Ȁ )@ $! !( !0!(@! !0@!Ȁ !8`@1&&2@.!0@!8`D&$!Ȁ  @..''! !(!0 !8! @$$!0@!Ȁ !8`@$! !(!0 !8! @$$&!0@!Ȁ !8`@H..e$t ! .$&$!0@!8`.!Ȁ !@@!0 E$ ! ! !(@!0@!8`!Ȁ !@@! $!0!8@& @ $$!0@!Ȁ !8`@ ..&*%$!0@!8`.!Ȁ !@@.. ! @..!#`! @$!0!8@..y% @ $%!0@!Ȁ !8`x@. !.&%.$!0@!8`!Ȁ !@h@.. ! a@..!#$! @!0!8@..' Q@$d$!0@!Ȁ !8`H@ ..$&$$!0@!8`.!Ȁ !@9@.. ! 2@..#!P"! @$!0!8@..Y$ "@ $d%!0@!Ȁ !8`@ ..$&%$!0@!8`.!Ȁ !@ @.. ! @!@..!#%$!0@!8`.!Ȁ .@! $!0!8@& @!0@!8`D& $$.m$$H.@..m ..e$.!0@$ ! ! !(@!0@!8`!Ȁ @!8! !(.'& AA.$$.$".-@ ..$$.!0@ ! ! !(@!0@!Ȁ !8`@.''! !(!0!8!  @$D%!0@!Ȁ !8`@$! !(!0!8!  A.s$. .H.!0@Y$ !8`e@@..!..'&H.! +!0@K!8`!  O@@.H.!@+H  .! $!0@!Ȁ !8`@@.H..'H.!0@! !8`4@@..!h%$!0@!8`!Ȁ .&@$H...H.! !0@! !8`A$. ..$. ! @!0@!  %&!(@! !0@!Ȁ !8`@ ..$! @ .%&!0@ ! !(@! !0@!Ȁ !8`@ ..h$.%&!0@ ! !(@! !0@!Ȁ !8`@!8! !(.'& @H..'#(!0 *$W(9!@'@'!0$*06(!  !(@! !0@!Ȁ !8`#(1( (! !0@@!8`9% @01&'.. !0 ! ! !(@!0@z!8`.!0@&!8`r$$&!0@!Ȁ !8`w@'.h, . ..'.'Ǔ.Г'E%!0@! . !(@! !0@!Ȁ !8`T@.H.'#(!0 *$@!@^(7%!*p6!  !(@! !0@!Ȁ !8`#(1(0 $ (! !0@/@!8`% )@01&'. !(.$... $;'./) $#$%$L!$.-`.. '.%! `. \..$! . T..&\.T.%! . ! !(@!0@ !8`! !(!8.'y% @.H.#` $!$2*@ q.!$xC&. '.$! . \..&.\.&$!8@! . ! !(@!0@!Ȁ !8`@.H.UU<#(DhVU5g 8#Xg%,' !0&@!@W(&!0$*P6@!  !(@! !0@!Ȁ !8`#(1( (! !0@t@!8`y$ n@01&.-.. '.%! `. \..$\.%.!8@ ! ! !(@!0@!Ȁ !8`I@.'H.!0@! !8`?@@..!P$&$!0@!8`!Ȁ .2@$.H.!0@! !8`)@@..$&!$!0@!8`!Ȁ .@$.H.!0@! !8`@@..$&!"$!0@!8`F. ! !0@!  !(!(@! !0@!Ȁ !8`5A$$'!0@!Ȁ !8`@c$!0@!8`D&$c*.  $' $U!8.].H.#0R& $G! !(!8.'' @!0@D$!8`!Ȁ $@.$!  ..6&!P! @ ..h$! . .! E& !0@.&.. $%!0@!Ȁ !8`@'! !0 ! !(@!0@t!8`&.! .e% ! !(@! !0@!Ȁ !8`n@.,* $%*-. H.!x+p$#D '!(!0! \. $( ,..!(  $. ! ..\.#(B!@!.. .H.+ H.$O&$D$!0@!Ȁ !8`,@7&! !(!8.'9& @$$!0@!Ȁ !8`@ ..'! @ .!0@!  &!(@! !0@!Ȁ !8`@ ..$. ! @&!0@ ! !(@! !0@!Ȁ !8`@ ..$! . \..%! . T..$\.T..& ! =<'!'<0!b!@@#(!0`l ikjmT$P (, !8<@'$ | P0L0XPPh  (P0P0$PHh  0`P]h  P@D | P0L04XPPh  h(P0P0$PHh  0`P]h  P@D0 8T8LUU 0U0``p|`` 8V8xaa DWXWX lT dU XVXc<c dWdD`L`X` xxaXa xxbXb f$ff,f8XfLtd|dXdHle|eXef $ff,8f(0 PTT UU VV(V W W 44``(`,`a`pRpaRa(a,bb(bPT$ \T\dcfc f TcTfddc UP\U$U \V\bb \W\``@aa` HTHtnHnPnX8n@nn0 0 n ntxnnLnlnnn nnnHn0n lUlxggXgPghgg0 8 g gt`gLggg\gDg ggdhgxg8g lVlaeaeaDaX`e`aeaLaaa0 L aaat aLa\a Pa(a\aaaaHaaa lWlX X` llhfh`f`XXfPfPLLxfxffL L X fX  f ffttffLfL@f@f f \\`f`fffddf`f llPP`X`X o 00LXLXPPXXXXtt_^\00LXLX0V0<W<llX  0 X0 D D    X 4 4  88ll(X(@@LXLttXWVnHHddxSxhttYnSpp<<DDLULgZXPPddXX``xXxX<<h(](` l l|R|` l$lh`h$<`<X$X`$,`,0$0L`L$`L $L  ` $ t`t$`$`t$t`$8`8$`$`$`$$`$\$\`$D`D$`d$d`$ ` `$ h(hD(DXX(hh|(|f( ( P (P   (  ( d d ( ddxfx` h,hD,DXX,hh|,|( ( T ,T   ,  , d d , `hlRlXXRXXRPR@LRRRh|f|`PfSS,@R@LfRRf0 < R< D fD L R( ` R R R\ d `d R `XdRR(R0dRRRRRfLXfXlRlf@HfHXRXf,4f4DRDfpRRDRRfdfRfhlRlY$Y$8R8@YYh``X`SX SLS@R4n,U|Yh|fhfLffhee0 L eeLleeXhaa0 L aaLlah``L ` `haa|L a ah|ff f fh`8 t a a \ `haha0LaaahaPa@Laaa0 L aHaahaa0 L aLlaHa(WWhee0 L eLleDeeWh`,`hxgg0 L gXgdgghaa0 L a\adah``D L `$\`D` (T $U$PSS 4V4XX XWW3k __ns_sprintrrfc__ns_sprintrrDX($`|,8 $|,8 $P\`DHlThP@P @PdXhXhhl0LPX$0@D48P0l|,0 $ `h px( 0 L T 4 <  d l p x XxPThp`dX\(LLl\H\DX($`ns_s_nsns_c_invalidsize_tns_t_optcharstr_sectionstypens_t_a6ns_t_atmalong long unsigned int__u16orderns_t_mailaonamens_t_naptrns_c_inns_t_minfoprune_originodatakeyflagstmp1ns_t_soaenospclong long intsigned charhexifyns_t_dname__ns_sprintrrfns_t_x25ns_t_txtns_t_pxlong int_flagsns_t_mgshort intns_t_isdnuint16_tns_t_nsap_ptrdoubleu6_addr8ns_t_sinkin6addr_loopbackns_t_nxtns_t_certkey_tagns_s_prns_t_nsapns_c_none_msg_ptrspacedns_s_anportns_t_anyns_s_arrdatans_t_keyunsigned intns_t_a__u8long unsigned int__u32ns_t_sigin6_uns_t_nullname_toupper_tab_ns_t_ptrrdlen__ns_class_msglcntns_s_qdbase64_certns_t_lockey_idsave_bufobufns_t_maxtargetns_c_chaosns_t_rpisprintnewlen__ns_typens_t_gposns_type_countsrdlengthpreferencepbitns_t_axfr_sectns_sect__be32__ns_msgGNU C 4.4.3u6_addr16addstrns_t_kxns_t_cnameu_charns_t_aplu_intns_t_nimlocin6addr_anyns_t_invalid_rrnumns_t_srvns_t_rtmsglenrr_classfloatns_s_znns_t_ixfrclassns_c_2footprintns_t_tkeyns_c_any__ns_sprintrrprotocolpbyte__ns_sectcommentname_ctxns_t_tsigns_t_mailb_tolower_tab_/u/raghu/ics_feb29buflen__ns_rroriginns_t_afsdbin6_addrns_t_mrns_t_zxfruint32_tns_c_maxns_t_mbns_t_mdns_t_mfcharprioritymodebionic/libc/netbsd/nameser/ns_print.cc_typeleader__uint16_tkeysize_ctype_u6_addr32ns_t_mxns_s_maxaddlenaddtabshort unsigned intunsigned char__uint32_tns_classedatasave_buflenformerraddnamens_t_eidlabelsalgorithmns_t_nsns_s_udns_msgns_t_wkshandlens_t_aaaa__be16_eomu_longns_t_hinfons_rrbase64_keyrootns_c_hsweightGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.ident.rel.text.addstr.rel.text.addname.rodata.str1.4.rel.text.addtab.rel.text.charstr.rel.text.__ns_sprintrrf.rel.text.__ns_sprintrr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 p0+>LpX^ppkZ  + np/ j `0+ z =H +X (+2@"l#( ؋H+$$ `+&` +XE (+ pE `+F 0+*pG& 80#+9pc75 h+!MpcHI p8+#`pd\ +%np0gky0[nomn}nw ,L 8}7   '.X6(=$!#%'EJOT Y^ ch$m(sHyL\`h8,04<@LXdpt %+17=()CLS[esz`)bionic/libc/netbsd/nameser/ns_print.caddstraddnameaddtabcharstr$LC1$LC0$LC2$LC3$LC4$LC7$LC6$LC8$LC37$LC39$LC40$LC41$LC42$LC25$LC43$LC5$LC30$LC38$LC27$LC22$LC24$LC23$LC9$LC10$LC11$LC12$LC13$LC14$LC15$LC16$LC17$LC18$LC19$LC31$LC28$LC26$LC21$LC32$LC33$LC20$LC34$LC35$LC29$LC36_gp_dispmemcpy__errnodn_expand__ns_samenamestrchr__ns_sprintrrf__ns_format_ttl__p_class__p_typesprintf_ctype___ns_get16__ns_get32__dn_count_labelsinet_ntopstrlen__loc_ntoa__p_secstodate__b64_ntopinet_nsap_ntoa__ns_sprintrr  @`Ra !%1>ELSXejw~%0;w,:HV*06<BHNTZ`flrx~ &,3:AHOV]dmy(:FR`{    $ ( ,@EP_do     8DHL`epu%)-6AFQafqv  5 9 V Z z ~             # ( 2 7 A T ^ c q {                " * 1 : > S _ q              ! / 5 L P i {              - 1 P T m q           (1=Tbrw+15>JVreptx9F^ A > LL8 M NLLL O P8 NLLP l N   LL\ d  Q  P Nd NLLl P P  D !L! ""   S0 TT Ul Vh #t# D $L$` %d%l Vh &p& '''  V (,(` )h) t   * **\ ** W  Sd   ++  \ X Y U V ,, Z4 - -<-@ .H.` [x \ [ -- \( V /0/` 0p0d 1t1 V )( )L   T  2 2 3 3 Y 4 4L VH 5T 5   6 6 Y 4 S0 T h 7p 7 Y 4 S  ( 80 8L Y\ 4 S   9 9 Y 4D Sl :x :   ; ; X0 V( <<<p   ] X V << $ P 2X2  2t | 22 Y4 ^L VX=| Y ^= V X V <<4 H d _ 22 \   `, \T :\:l .t. >> X V ??$ _P 2T2` \   [, XH Xd X X V @@   AAP Ut X V BB _< 2@2P \   X X V CCH P| 222 2(2T V .. >> DD V  --( @ T 2\2| X X X V EE \ ::8 V4 F  F<Fd GhG V| 00 M$ [@ \ 22 .. >>   22 Y0 ^L V =X=| Y ^ == V X X X8 V0 @L@LLX R !! 48 hl 8 l     $ + / 6 : I M T X _ c j n }                      ! % 4 8 ? C J N U Y h l t x                          " ) - < @ G K R V e i p t {     ")-<@HLSW_cjnvz04;?FJQU\`gkrv},07;JNVZlpw{  '+26=APT[_fjqu| !%48?CJNUY`dkovz &*15<@GKRV]ahl{      " * . 5 9 A E L P X \ c g o s z ~                             ' + 2 6 > B I M U Y ` d l p w {                           # ' . 2 : > E I Q U \ ` h l s w                             # ' 1 5 < @ J N U Y c g o s z ~                          $ , 0 : > E I Q U _ c k o v z                       "&-1;?GKUYaeos{ '+59@DNRY]eisw~ !)-48@DKOW[bfnry}&*15=AHLTX_ckovz!)-48BFNR\`hlvz %)37?CMQY]gksw,07;BFMQX\cgnry} ")-48?CJNUY`dkovz #'.29=DHOSZ^mqx|  '+:>EIPT[_fjqu  $+/>BIMTX_crv}  '+26EIPT[_fjqu !(,37>BIMTXgkrv} $(/3BFMQX\kovz  (08         $ 0 4 8 < @ D H L P T ` d h l p t x | (,048<HLPTX\`dptx|  $(,8<@DHLPT`dhlpt  $(,048<HLPT`dhlpt    ns_samedomain.o/1331265337 1002 1002 100644 5744 ` ELF P4($!?00% RU$ > : ; I$ > $ >  II!I/ .? : ; ' I@ : ; I : ; I 4: ; I &I.? : ; ' I@4: ; I Y{Qint8;*d? )8 src dst3 0 n0 ) a btaʘotbʘws bionic/libc/netbsd/nameser/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includens_samedomain.cstddef.h>HLLI}IKKw<=$M>Ozts$NetBSD: ns_samedomain.c,v 1.2 2004/05/20 20:35:05 christos Exp $<'!',($ !!@B$+0b4 ! !0H.$&\$$.$&@B$L& . JEKe&&&!0! $!#. $M !,($0'&"&$ a$D$<'!',($ '!$ !(A$,($ 0''! !(@ $@!  !(@B, | 8P0L PP | 8P0L 4PP80 ,T 4U4aRaRaaR8a (VD\S(S<`8` <T 4U4Ta`a3]__ns_makecanon __ns_samename$88long long intunsigned int__ns_makecanonunsigned charsize_tlong unsigned int/u/raghu/ics_feb29long long unsigned intbionic/libc/netbsd/nameser/ns_samedomain.cGNU C 4.4.3charlong intdouble__ns_samenameshort unsigned intsigned chardstsizefloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.ident.rel.text.__ns_makecanon.rel.text.__ns_samename.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5 ">Lp^ph]Z " npwj 0" z<B8 @(" h("pPT  "T "pB p"p:7 0"pq( 8" p P "p0 $0 -o  =# s    ,8;DKRZhbionic/libc/netbsd/nameser/ns_samedomain.c__ns_makecanon_gp_dispstrlenstrcpy__errno__ns_samenamestrcasecmp  !%1>ELSZahov}    !.; V  P  $ `    4 8  8      $ 3 7 > B I M T X _ c j n u y                       $ ( / 3       regcomp.o/ 1331265337 1002 1002 100644 83276 ` ELFP4(;8000Hh0`h% RU$ > : ; I$ >  $ >  I&I  : ;  : ; I8  : ;  : ; I : ; I8 I!I/ .? : ; ' I : ; I.: ;' I : ;I.: ;' 4: ;I4: ;I: ;I&I : ; .: ;' I .1@11RUX Y1 U!41"1X Y#.: ;' I@$: ;I%: ;I&4: ;I'.: ;' @(4: ;I)1X Y*1RUX Y+4: ;I ,41- 1. U/ 0 141 2.: ; ' @3: ; I4: ; I54: ; I64: ; I74: ; I84: ; I 9.? : ; ' I@:4: ; I ;4: ; I<1RUX Y =1X Y >1RUX Y ?4: ; I? < {#'(int{;JK>_mP 0 1)# W20# &3# 4# T4 )# E# )# )# # # )# @# S@# @#$ )#( ^)#, V)#0 )#4 #8 #< )#@ 0#D )#H @#L i#P[5 uch*I sop>s?l i ptrj# k*# dl*# m0# 8n# *3oKyI5  ' (# )# 8*# .'8 (# )# p7 W8# end9# {:)# E;# "<@# =@# {>)# g?# CA# B#H@ )c)z)c))3c))Oc){)vpve)89p9vcs9i;)top<css=0a)gc)coli))uc;5)gc1)c2)coli))uc1;uc2;\p\v\@sp^:k)ck)pvcscpj0npopvcsspcpolen0ucuY p vcs c"*"pvno)nc00cscss0i)*ptrrpvcsci)YchY)pvcspvcsnch~) p~vcs~i)css0n)n)^pnvcsnip)cssq0+O)pOvcsOhQ*iR)topScs2TcssU0(k pkvchk)mjno  NG pNvposN@cN5 pvj  r\) p\v^)_)? pv2 pvg2c)c2)catpU ppvgp pvgi7@s5cpi@c@ pvgs5r@@>L pvop50 * 4 T? H  !"Oeka#q@s $pv%@%@L&ret@j&len@H0 H!"Oekar+ p+vop+5+0pos+@sn-@s.5i/)s #  & Z m ! ! ! 'DA$pv%@M% )$to).(@!@)O ka* ` : . $ * 0x : . $ *  : . $  0: . $ >p>vv?)spAcpBlenC).,p,vc.'q$pqv&cssY+ t),* !2,!c,!!- . m,O(80ak*"PX:0 !E,O![!ga )O$@ak)O<h ka)O<*ka)OIka)Ohka)Oka)Oka*~8B h,A$]S ,i!t !k )OQ#akOhHka*8 ,)O 6kaA5]S ,i!t ! )O Qak"O $Hka*PH ,*AP5]S 8,i!tT !N)O0XQtak"OdHka"O6ka*T-# ,8!C2,N!Z!d)Oka*|8/ h !1, O< ak*O`ka)O  ka"O @ ka)Oxka)|:/!!,*|v !!8,. &i)Vci)*r @*3 p`E ^ " ( 0 < &i))< p U/< p !, !J*^| zp !!!,,|@c !,, <2 0!G,Q3pvch)cap`=]!&*@H}*r``x !! 1h )@pv)c)))pos@i)P@' $pv@%)%\)(@()%()*t ,,!,!)[,3*O ka*O|0 P>ak*OtH ]ka* h B , , "O 4 fka*Oh Fka)OOka)O40ka)O@`ka)O|=ka)G |U /!_ !k 11w )O <4ka  E , , "O4 T fkaO( ka4$Yp$vc&pos'@()))P*@+)2 Q3pv4)5c6J@6@=7@8)$*< u H !,,,(!4,@!LD* \ ^ , , "Ol fka) : . $ ) `: . $ )O$ka)Oka*O8 ka*  H , , "O< \ fka)O@@gka)O 83ka)Okka)Opka*Ox _ka)OdxZka*O<( !ak*G P cXU h ,_ !k 1w "Oka* P : . $ )Oka* !s j a    ! "OD p eka* T  E: . $ * 0 s j a  P   p ! "O D ekas      , 1  ! $! 6s j a     0 ,"Op eka9Hc)7!"4E"X!4!4)!:pa8~;g;pv;i)5len0W"< P ! *  QH !&"*PS  p,!"1~*m *  s j a P  ,"Oekar"Oka< 8!  X! 5#, ! S#!% |#)T!/T!#!#!$, "(=2/!H6$!Tj$!^$,j!v$<2 lx"J @ Ouka   ! &! &, ! &" 8+#"#_8#*&##;# 8>k+#?8?9f#l#P?B:f#Z- bionic/libc/regexbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includeregcomp.cctype.hregex.hregex2.hstddef.hutils.hcclass.hcname.h $HL<DJuo<=}IKIK ,H<$}IKIK $ntIKLNFNJKIKLE ,KI  <J]J  JjJ }  9IKKHKvJ Q0<(uSJ-JY,($$|JJ|$<|JJ|$!_(t$}JJ|$t}JJ}$K(tr(uK<}OFHLIILuL|J<mJJJJJ~JJ}JJ{JJ~: < JIKKKI<KI}JIMIKKI|0JJJJ~JJJ}JJ{JJ~IK9, JKK}K.zzJJ<KIzJJttJJKIHKG}KlJJIJJJJJK~JdKKK}KK}K<tJJKK~$ytv <~NEJ|JrJKJ|JrJKJ#_J!<4,?0 rt;KIy]|J:]]alnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblank cntrl digit0123456789graphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzprintABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~space upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL<'!'d`\XTPLHD@!&+@$!  $@$!  $@" R!@K& K0*PP@Sdb@F&E* 0Esp<7!!$W@ $@I 72+8^$1U,]$S- $M&ԏՎ+$s&]$-$$( ;@]$2&+@p9[ $|!:$~o= $=m@[$.$'! +`^$! *Ȕ 2!x &%h*!`27+@@]$&%"@$"I%))L@# yhgY!@ !N0!h'$B$#`G %d`\XTPLHD@h',+ԏՎ$s&]$-$$( 䀏'- %8I--&72+@:$〄o= $&+ 77$833'₇^V%+`UH0&!8D0!!c$+Pe @#kl1u! 1 c$c$#w@%! @!0`8 !(8@! Cb &@"@$"33!`@$"22@$%+pr<! :*Ȕ#d$+Rtf$[ $q.$Wn$+'~!@!@"!@@x!@%+C + RE. $JV+ j$#@c%! !(!080 44!8@0a@c$w$S,$.33! %"+hRW$+@.$XA)  $*3 3, $9!`%33+&+ @7'$(33$₽^V2+R!=$N"!@b$+HR !( JFKv+r@@ @#w%! @!0`8 !(8@!CN&@$Yo-$733!(!!E%8G!f"2+R)C$"@$"33!`@$"!@22+"!`@$#!(22!E!%8G!f"2+RC$+rI=$4"!`?&+p7!"!@b$+xR!(M.$X+r(#f$! !0` 88@!&$Ie"@$"33!`! @$422 !"@$"33!`&$%33W&!@@&_0!H%(E!b@c$T72!(@%#0   ! @M$!MO' ! @&!" !(@ &@! C  *@ $+! @3 3M$!MO2"+R C$+ r:$_"U!`"L!`!(`-G0)%&@$C0!ӓ$i$j!0CƐ@P 00= c$!@*f0b! %! B$G-,,`% $%#d 1!(D '8 $`$0%8%! -0  /'$p . % -!!T0!w$$ B$H  $'k a!p+X`! $+H ON  ?Y$$++8! B$u$$t++CB$G0!('H!G+P@@!O0!('`$XB$#hH -%.#! d9&`\XTPLHD@10< h'&D0 )0@*D 0 ,+` $.d&//`\XTPLHD@h'JTVK$!`++fK$"U!`€r, !(@- @!èrB$!pnRc$#h! !( !0`!#D&$%R& $@I 72+8/,! <9% !0(d%'`\XTPLHD@h'! <*-I%8(-G-$72+",@$)"㒮!(`0@!xC'! +H $+PR@.$c"!`BV$':! 7"&%]Ɠ%]ߣ]'72Q+&+7@7$J,͐$`4!(B$/$0!!(' ! & Ɍӌnj !@~!N0!x'$B$#PnG %0 %  '!  $ₔ,!(>.$$!&*8*Ȕ( $+33 % $2-$'$(FE$%d6!<'!',($ !!b0(@80(!8E0!J03@$@`!XbQ'' ]$! $ ,($ 0'0! <y% !Q*@, 4%-4,($ 0'X0$@!".<'!'\XTPLHD@<8+8b!!h f^$L` ! (@#0'<%!Hf$G h!L<#P$X%HKI* !8E$!%Cx@!/*pQH$!<0G!0!!(f$84 (! @8@4  ( 4@4(@#0'<%!Hf$ !0 !0 #&0*("<#&!`!  #Xw x<8%H!P!Iq! $ $$D*`$$MLD*p$LOc$gB$ &#%@#w! 0 !(  !0Ŭ(b $MB$aF$!xC@p!0*hF!` (8 48%@4 $ P!j<#&$v% $ ^ $ $ 2@ $$@4d<'!@'0$$!!CC$ 0 ! !@ S$O@!@B8@@!($, $(@@0!T 8$4<'d'@(@B$C &$$48 P&!($ (,0<@ D'! @@$<(!!8D E4L 00e4) 0@$$$W% !'+ K#Z st24!`$04!h &&* >@ 1!g!PiW7 ! !Xj!f! !dB$!(iH!g%%$%%w00 ]$ &  $'X0v&@!b !  $ %b<X <$(GJ6!!@!` < <<<n5p<x<h<<H<d$+#+ !@*h@!`%!@!b$(Gd$$ J! b$(G !( d5(`<!b< h%!@,(%!8!( <H<P < <M$hB$ j*k4(!M$ 8B$h$$.$$_$! }! $<G@! @@ `!8C! @<<B$`FR&$$7! ( ($@0(, ! $! @& $! @$& $$ $$ $(o& $ $$b$ b0@!8(X\dXXXXXPXXt|XXX X<DXX\`dhlptx|            $(,04 8!L"\#h$t%&'()*+,--..// 0(1,20384@5H6L7T8\9d:l;x<=>?@[\\]^^0_<_H`X{d{x|}}~ | P0P$P0XP0P0DPHh  0Phh  `P0P0 P`h  0 Phh  0Ph   | P0P$4P0X\P0P0|DPHh  0Phh  `P0P0 P`h  08 Phh  0lPh  0 4T4t`t|T|` 4U4TaT|U|a \VdVL|RR0 \T\`T` @U@bUb lVV8\c\pTpccTcT0aaaXxRR0 0T0@`@HTH` \U \V TWWPpbpb|SD lTl`Tp`x`` D` lUl8RDRdRR RRRRc 4R lVlbhbxbb b Db lWlaSaWlalxWxaa Dap8VDVVV 4V LTL$a0ataaaa(`0 ` V ` T @`@|T|`V`8x``T``TH`HTVT`blVx(VxVV$VLVL V  V $ Vp V V  V< L V| Vpb8b8xV$VVVVVV@VTVV``8`clc8c,RS@SLSpS0RxRRSS$R04R`dR S R @ R  S S8 L S| S$,S4SSSS@TSRdXTXd0Tpdd4d4xTTDTd`dhdP d d d  d \ dp T dT d T| d$d $d0LdPdTdd$T$TdTxTxTT0T0LdL0TptT4TxT4TT|TTLxTl T @ T T \ dp d T T dT d T| d$d 0T0LdXTdTTTd@TdTdXddpt\t`ddd \ dp T d| d$d$Lddd@TddSS S$(S(gLTg@g\ ` W` gLgg@gTdg@SP p S SLxSSSS@SLSpSS[S(SXS S  S S8 L S| S$,S4SSSSTSSSXp$XxXpXXXXXLXx X @ X X X 0XXXXX(XTpXxXdXdd_dL`d@ d \ dp T d| d$d0Lddd@TdL P gP S | bP R Rx RdXdddL`d d \ dp T d| d$dd0Lddd@Td0RR0XX0RR0XtX R R P R| R RR0LRR , X8 < XP T RT h dh R RRR,R<DRP`RRL S$,S4SS`SS@TS P____@T_ H XL X< X R$X$HRHXRX0LXX`X X R@DXDTR ^^^^HR@TRf$DUDLfLPUPfUf`0 ,T,``(`0`` @U@aa0`a4b b0`bab  `T``Tp`pxTx ` `U`dSdSldltStdUd4S4LdLSd(`d`xUxddSd`d`hSh|d|SdDSDXdX`S` d `V` HtatXaXaaXHaHXaXa8X8DaDxXxapXpDaX`a`tXt|a|X<a<PXPa T al aVlV VHV(xVV|VDVYlYYHY(xY Y`dY|YPYh t YlVl|WVW  V  W 4 V4 T W,|WW HWWxWXdWS , W$dUUlpU4HUxUh UU 4 U U(pRR@HRRxRoR  Th`x` ` Ucc c cUU$lUxUULUU4UUU@DU$ ( U D U U ( U U US4 S@ S S T Th p S TpDgD\V\gVgVP gP V W g V W d gd V g V g V g< D WD gT<TDdTxTLTT4TTTU@T@HTT$<T T$ ( T THVVW< d Vd W Wl l Vl WVlVxVVV,4VV|V V, @ V V D V V VTbeSb\S\xRxbSbxSxbXSbS,b,4S4LbLWS|b|SbR$b$HSHbS b S b S b S b  S  b R bR0 h R R< RD p RT T  T R < R< D T , S XTXa(aTa XUXHbb(8b8@U`bUb PVPcclc(@c`cc4ctdd8@dde e@e8eeeteDeeccDLc4`cc_l_\T\\ \dT dd4Ddd4STST`S R<RTR RlUTxU[h[t[ [ RTRt R@XHXT XYTY YbScbdTdhShxTxSTSTSTcTtbb4DbbXX|RRRRTWTWTT(S$SS4<SSLRTtR(]t]4<](W W `U`dWdtU4<WW#Qregcomp\D` HLHLH\H\048d048d\HTD\HTD8(,HT0DPtT@L 0  `p8XX|PtT@L 0  `p8XX|$0 h$0 h$0 xht$0 xhthtxL $  dpL $  dpLX $ dpLX $ dpPTd<PT@D8<lpX\PTd<PT@D8<lpX\PTdhX`dPT@D8<lpX\PTdhX`dPT@D8<lpX\TX@ `dLPDH<@|dl\`TX@ `dLPDH<@|dl\`|X`$( `d X \ P X \ P < P X \ `dTXHLpt`` 0L 0L8 L ( , <L @ H ( , | @T| @T@@T@@TPP@DHT`|0`tx LHtx LH|tx`T 4 T 4 hldX4 T X4 T (<@L<@l  |`lDT<@l  |`lDT\ l \ l 8< < \ < \ x<@t|PTHHP\ T D p l 4 D p h l D H @ 4 D p h l D H @ T l D D D p l p l p p p 4t `@T4t `@T4t `@T ` `4xP\4P\4tT lT llttD` GNU C 4.4.3frommlenconc_ctype_cnamesallocsetcsetmultisp_strpregunsigned intnextend2isinsetsoldendduplendcerrormcinvertiflagsprevfwdsmultisp_brefirstchstripsnugcategorizep_b_coll_elemsizemcaddsetbitsfloatcountcount2mccasep_b_symbolp_simp_relong long unsigned intfreezesetsamesetsnulspbeginprevbackfirststatenbolvaluecatspaceplusnestsize_tstarordinaryopndncategoriescsetsizemaxnestp_eretouppercodecclassslenoldnextfinishcharnsubbionic/libc/regex/regcomp.cnonnewlinerepeatbackrefsinvert/u/raghu/ics_feb29isalpha_toupper_tab_subnoneolregex_tpluscountlong long intseterrdofwdre_magicp_b_cclasscharsmustcflags_tolower_tab_nbytesscansopnopendend1maskndigitsothercaselaststatesetsisupperre_gutsnomemre_gbracketcopyre_endpcnamep_ere_expshort intregcomplong intp_b_eclasshashnewstartp_counttolowerfindmustnstatesparsenamestartwascaretmagicenlargecat_tncsetslong unsigned intp_bracketfreesetordinarycategoriesunsigned charpatternnplusfirstssizebothcasescatsnewlendoemitstripsigned charre_nsubshort unsigned intdoinsertncsalloccclassesp_b_termdoubleislowerncolswasdollarstopGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.doemit.rel.text.dupl.rel.text.doinsert.rel.text.repeat.rel.rodata.repeat.rodata.str1.4.rel.text.p_bracket.rel.text.ordinary.rel.text.p_bre.rel.text.p_ere.rel.rodata.p_ere.rel.text.regcomp.rel.data.rel.ro.local.cclasses.rel.data.rel.ro.local.cnames.bss.nuls.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 H9>xLpxX^p#Z 49 npO(^j H9 ~;z <(9 < d09= (9>D 9BP 924CH ,P9\` |P9 ]  9g  H9+lud' 9 =v9 9"OK (9$oXk 9&X pX 9) H9+p5' 39-pŭ *9/p` *P91pCx *p93p00uo:0     $ ().7D>H&O$X`a g  "$&()+-/135mr67w"bionic/libc/regex/regcomp.cdoemitnulsdupldoinsertrepeatp_bracketcnamescclassesordinaryp_brep_ere$LC0$LC1_gp_dispreallocmemcpymemmovestrncmpfree_ctype_strlenstrlcpy_toupper_tab__tolower_tab_memsetregcompmalloccallocregfree  @`< )))!(%1)>)E)L)S)Z)a)h)o)v)}))))))))))))+)9)G)U)c)q))))))))))) ) )A)b)p)~))))))))))*)9)E)a)o)}))))))))5)P)}))))_)))))))v)))) )#)P)\)s)))!)_))))) ); )H )` )l )x ) ) ) ) ) ) )3 )V )x ) ) ) ) ) ) ) ) )@ )Q  U  Y %f %o %x %  ( ( %   )   % % ) % ) % %) %2  6 (H (Q %Z  ^  t ) )   % % % % % % % %$ ), 0 4 %F %K )V %[ )f %u %z ) % )    (  ((%)(B)^)))))%%%)(#(,%:%H%Q%Z_(rv(((%%%/3NRmq((((%%  (,(GK(\(jn((%%(( $(:(H%Q%Z^y}((%%%(48(O(X%fj((&%/%?C(Y(b%k%w(%(((%48A%O%Z^(t(}%%%((%((%)8<@%M%V%_%hl((((%%))))4)A)IMQ%c%h)s%x)%)%)%)%((%% ($((CG(bf(w((#'BFW[d%m%((()))5)A)M)Z)aei%z%)%%)%)%))((%%%"(3(FJcg( ((04MQlp( (&*(;(I%]az~((((% &*(JN(mq((%((%(('(59S)^bf%o)y%~)%)%%(( ( %  (6 (D %X \ (r v (  ( (    (   !!($!(-!%;!%D!%M!Q!g!k!t!%}!%!%!!!!!%!%!%!%!!(" "($"("(="(F"%Y"%b"%k"%t"%""""("("%"%"%")" #)"#!<#)H#"M#)Z#)r#): p    00 1 ""00P 1d 2 ""00H P 300< T@ X ""$ , x           (         $ ( , 0 4 8 < @ D H L 00X 4T *\*x 4t +|+ 5P !X!T \ ` "8 "p" ""8 !@!< D H "T" "" 6   4 4 !! 4  4D "T" "" ""l !p!t 4 4X !\ !` 4 4 "4 " 7 7 7 1 8, 5P 7 6 9 :   1 5 5@ "H" 1 ;  P T00@ 6d :   8 900t ""x |     $  h "|"  0 "@" ` h    00< "P"D ` H dL hd l | "" ""   L t "" 0  < ( 4  ( 1 10 3 1         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                            $ ( , 0 4 8 < @ D H L P T X \ ` 00` 7t = > ;H X  6 :X 1  l 1 "" ?< =( D 9 5 = ""D L` l "" ""  $(,048<@DHLPTX\`dhlptx| (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx# 4#8 \#`|####8#<l#p 8 `<p     $ + / 6 : A E T X _ c j n u y                       # ' . 2 9 = L P W [ j n u y                      &*15<@GKZ^mq$(/3:>MQX\cgnry} .29=DHOSZ^eipt{%)04;?FJY]dhosz~  #26=AHLSW^bimtx$(/3:>EIPTcgnry}  $+/6:AELPW[bfmqx|      % ) 0 4 ; ? F J Q U \ ` g k r v }                              " & - 1 8 < C G N R a e l p w {                               ' + 2 6 = A H L S W ^ b i m t x                             ! % , 0 7 ; B F M Q X \ k o v z                            $ + / 6 : A E T X _ c j n u y                         %)04;?NRY]dhosz~  #26=AHLSW^bimtx "15<@GKRV]ahlsw~ %)8<CGVZaelpw{ !%,07;JNUY`dkovz  $+/6:AELPW[bfmqx|  #*.=AIM]ahlsw~ #+/@DKOVZaelpw{$(/3:>EIPT[_fjqu|  $+/6:AELPW[bfmqx| %)04;?FJQU\`gkrv  '+26=AHL[_fjqu| "15<@GKRV]ahlsw %)04;?FJQU\`gkrv}  #*.=AHLSW^bimtx,07;BFMQX\cgnry} &*15DHOSZ^eipt{ !(,37>BIMTX_cjnuy      % ) 0 4 ; ? F J Q U \ ` g k r v }                      ! !!!$!(!7!;!C!G!X!\!c!g!n!r!y!}!!!!!!!!!!!!!!!!!!!!!"" """"#"'"."2"9"="D"H"W"["b"f"m"q"x"|"""""""""""""""""""""## ####"#&#5#9#@#D#S#W#^#b#i#m#|######################$ $$$#$'$6$:$A$E$L$P$W$[$j$n$u$y$$$$$$$$$$$$$$$$$$$$$% %%%% %'%+%2%6%=%A%H%L%S%W%^%b%i%m%t%x%%%%%%%%%%%%%%%%%%%%%%&&&&&&&*&1&5&<&@&G&K&Z&^&e&i&p&t&{&&&&&&&&&&&&&&&&&&&&'' ''''"'&'  (08@HP       $ 0 4 8 < H L P T `dhlx|  $(,8<@DHLX\`dhlptx|  $(,8<@DHLPTX\hlptx|  $(,8<@DHLPTX\`dhlpt  $(,048<HLPTX\`dhlptx|  $(,8<@DHLPTX\`dhlptx|  $(,8<@DHLPTX\hlptx|  $(,04@DHLPTX\`dptx|  $048<HLPT`dhlx|       $ 0 4 8 < H L P T X \ h l p t                                $ ( , 0 4 8 < H L P T X \ ` d h l p t x |                             ( , 0 4 8 < @ D P T X \ h l p t                                  $ 0 4 8 < @ D P T X \ ` d p t x |                                  $ 0 4 8 < @ D P T X \ ` d h l p t x |                               $(,048<@DPTX\`dptx|  $(,8<@DHLX\`dhlx| ( , 0 4 8<@DHLPTX\`dhlregerror.o/ 1331265337 1002 1002 100644 7900 ` ELFP4($!h% RU$ > : ; I$ > $ >  I&I : ;  : ; I8 <  : ;  .: ; ' I  : ; I4: ; I&I.? : ; ' I@: ; I4: ; I4: ; I4: ; I 1RUX Y 1 U41I!I/ 4: ; I? < 9:0int;oJ+a~gj0 1)# 20# 3# 4# Tm5 12 2)# E3# 24# vn \vn uv v)rxytWd0SO)!\OnkOO0rQylenR0`S);sToUS2XYNCdc1s5c#8$9P{:d bionic/libc/regexbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includeregerror.cregex.hstddef.hctype.h,yJQ~J GC@o$$aJJuKatN]0%dREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEtrailing backslash (\)REG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEout of memoryREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***<'!'d`\XTP$!2!$$8$L$0 B$C`0 R ! @S$d! !(@ !0d!``\XTPh'`'F%! @ 2$R&$S`D !( R&@'%!8`E'! @ 2$$$$$ <Hdt,8 T` t    0<`l | $PhX | $PhX TTT (TT`T|T UUU (UTXU|U <V<aa <W<``PRRThRRDWWThW|Wbt|b DbptbregerrorTp|Tp|re_nsubre_magic/u/raghu/ics_feb29_tolower_tab_explainbionic/libc/regex/regerror.cregerrortargetfloatregex_tlocalbuflong unsigned intshort unsigned intsize_tregatoiunsigned chardoublere_gre_endpcodeerrbufunsigned interrbuf_sizererrsrerrlong long unsigned intconvbuf_ctype_long long intGNU C 4.4.3nameshort intre_gutspreglong intcharsigned char_toupper_tab_errcodelocalbufsizeGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rodata.str1.4.rel.text.regerror.rel.data.rel.ro.local.rerrs.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 ">xLpxZ^pZ " nphj " z2 "<  L"p 8 \"@ 8 l"px  t"p#  t"pB  |"pb @ P" p0 +0@4oRbDH# Xd   $ ) .  3<ELT]bionic/libc/regex/regerror.crerrs$LC2$LC1$LC0regerror_gp_dispstrlenstrlcpysnprintfstrcmp !%1>ELSZahov}$3DOZ  ) -CLt   L T        D < H x|        ( , 4 8 @ D L P X \ d h p t |                     ! % , 0 7 ; B F M Q X \ k o v z                          ! ( , ; ? F J Q U \ ` o s z ~             $ 0 4 regexec.o/ 1331265337 1002 1002 100644 156456 ` ELFpP4(1.@@@@xxxXX% RU$ > : ; I$ > $ >  I&I : ;  : ; I8  : ;  : ; I : ; I8 I!I/ .? : ; ' I : ; I.: ;' I : ;I: ;I4: ;I4: ;I.1@1 14141.: ;' I@: ;I: ;I4: ;I4: ;I 1RUX Y!1"1X Y#1X Y$41 % U&: ;I '4: ;I (.: ; ' I@): ; I*: ; I+4: ; I,4: ; I-4: ; I .4: ; I/4: ; I 01RUX Y 11RUX Y 2.: ; ' I 3: ; I44: ; I5.? : ; ' I@61RUX Y7 84: ; I? < !W int;'q 0sc@J} lC:.0 1)# B20# Q3# 48# T48 )# c# )# )# E # o# J)# # # b#$ 9)#( )#, )#0 )#4 #8 Y#< )#@ 0#D )#H \#L }#P57n 8# 9#:I uch *I sop>s?li ptrj# ky# ly# m0# ln# yowyI ' 4G gH8# I)# J# 5K# L# M# N# O# Pl# stQl#$ :Rl#( tmpSl#, Tl#0n 8G gH8# I)# J# 5K# L# M# N# O# vnPl# P#$ stQ#( :R#, tmpS#0 T#4f)cf)m)4!stl:ltmplpc)!) )i)'FmF)4!st:tmppc)!) )i)DlgD8)E4FbefGlchH)aftIlcsK sLpcM/Nl@OiP)L^^Th!tVWUtzDgD8)E4FbefGchH)aftIcsK sLpcM/Nl@OiP)^(lpTzVWBab9t m)4[!levrec) i)ss' spf v  sspdp len03 ^)sQ l cs   ! ( !"PX !#!t mF )4]!levrec)i)ss)sphxsspdplen05^)sSncs  @Y ! hs !"PX !#!iV m)4!stlltmplpc)!) )i) p     9   $  $ 4 R' 3 ? u$I  LC !"!!! !!%"X`] ! | #w !"# ! L86 !"!!! !!%pBUD# !#3m#)#0 4#d !# &#i%)ss& es'X!sp(!stp)9"4*"+,"-8#ssp.#sep/#'0$dp1mF)4!sttmppc)!) )i)3X #E#O$[$gR%s'($8$<$(B()^*$4 ^!4!+!$!!! %**+"! H#!"#!! ^`6!4!+!$!!! %,(,8-#  !#K-m#Fl-)#-4#-!#.&#i%)ss&<.es'.sp(_/stp)/4*/+,i0-0ssp.0sep/1'0$dp1(%)*D1)g8e1*.1*02*j3*)3+3,i)4-mv'~.m,dpB5,gfk5,gln<+)</40 !!!!!%0(KU=k\?w?3?_ Ll!"!!! !!%?cA Lp!"!!! !!%ABD L,@.!"!!! !!%FF H!"@Hb!"px|! L!"!!! !!%HGGH#`h!0 K! ! !} !t !k %    H3 J? KI  '  ({! L H!"!!! !!%BKhL L=!"!!! !!% MMO" W!"@H#q! L6!"!!! !!%8OOQ LX(3!"!!! !!%xQS#LT#!1 ! ! !} !t !k %    8S3 V? VI  ' L %(!"!!! !!%DWWd L(s!"!!! !!%`d^e ! L!"!!! !!% eeg"# ! L`H 6m!"!!! !!%x ggh"$$ !#$$#!2)Gg83.3033)4.i).mv.mF.dp.gf.gl4)445e)$ir!*r!=i*.Pi*0j*j*)j,g8xk1` !!!!!% kol$~ l&:m0;0x !!!!!% nm$m  n#o/p9" ! ^hH !4!+!$!!! % =qfqr"7!"Q!"t|k!6^x !4!+!$!!! % 1rZr>s03 ( 0 !!! !!%P \s$ssuu"^4(!4!+!$!!! 74#vv" #! ^ x !4!+!$!!! % vzw ^ !4!+!$!!! %( wwnx" !"  !"4D#!6^h 6!4!+!$!!! % xxy13 !!! !!% y$$ zzz"""  !"dl# ! 8 # !" !!6^0 !4!+!$!!! %h {{|Ux!>888C9!!P8":!'&w bionic/libc/regexbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysengine.cctype.hregexec.cregex.hstddef.hposix_types.htypes.hregex2.hutils.h(RKJpJJpJ!J`J8JjJ`JJJ8JJJ `JPJ,8=B, _<+(KIKIIAKJJ4<<Fr(R"_qJ6YJqJJJ6JJ `JPJK>HLHL,L, _+(IKIKKIK[:[JJ$IItI<>Vr2J6<J aJJuJ<DJ|<J|J|JJ JK_J08J~0sK JJsJ~+I|<|<#oJK!_JK J`J ^JJJ<JK+KIKIMJgPtEOIMt<=KIy=K,<=<C< f_(M<FjpI<z<=C<$<K<znpzLzJ<K(vyJQb4y<gJj~-<oJJJ tp@J~J$ yJ$zIu dJJ~J~4MMyJ$K ,>HLHLt( $5t(>HLHLYt:6F:uI< It<V)IIVtn6zLzJ<KwP1< I~t.tf4S <oJJJ tp@J~J$ yJ$zIu dJJ~J~4MMyJ$K IKIk ;yM}fAKI {KKIKIzII~oIKIKI;;Kz <rMKL:LJP=AzJJzJJzJ@JzJJHzJJJzJJNzJPtJ JtJoJJ`J J^JJJ@JK+KIKIMJGJ;=C<t<ILz0ztH#oJpJqJ J`J oJ8J<JK+KIKIMJgP$IMoI(<=<C< nF$IA<z<d<(<=C<<F<)<E;<ztLz+oJpJqH=A[%J[JH{ y<E h=0C+KIKI<gJ.t7;t<=?MaKIKI$z;K<{KIMGKIMGMBFLH=@>$sKI KHHL<yJQxJ Ju0@qtKIzJPKKIyJRKIKIKOuy  MFPKyLKLKKvIIK;MIKHLGIMK,zJJTJ~KLFKMPIK,>HK$zJPzJIQ~J{JJYJoJoJLz^ $$ e(>HHJZt=IIKKIK~<,~{{{J<utqJJ~JL{JJJ `JH@~{II=I( ~t{<M{JJKMQ(KJJ<zJJD>HLHJt,>IIHOIQJJoJzJJJYJ^JLJGJzzzJ<HLL(=/tzJzJJbJJJYJ^HJg(LHv@ 5<:o w.IKIuKIKP sKu$<I<(>HHJ<$>III;m=IKIKKIK =I( at=IKIKKIK~(HLHJt$~ {KIt>III( <z<<qJJzJJJJX+IKIKIKR0k>HHJtt>Iy=I( M<>~sKItc w"4<coz=IKIKIKPzI 0{J,>HLHLt( 56V:pIA<:< I~tzLzJ<Kw8lOI{ r,KIMGKIMGMBFLH=S||>:,K'<840,($ P?T~'!hY 3 <X <<0<$<$`i<h<@<<@R6n546+6+h-+ȓS  <5+h <( <$!(`!hY$`i@@$@`%$hHm%b$!(`<840,($ @'E+Ȕ h <5+hp<x <$$`<$@`%$\ <5+hb<~ < $ $@`%$@ <5+hKH<P <$`@h %$`r$Hh`$Ȣ %$M $hr'@ !$@ec$$H` $h!M-$`  $$Ȳ!`!h !hY$ȩ/$Ȳ `%$ $ $~$hr !lc!ȍ,$ȃs $@`%p$$@`%k$8<$f$$;$s!($5$ -~`/$<'!'tplhd`\XTP 0<<<!#&N qH~"%_,!`h+1!p$ˍ<0<$(g<5+`I+0  $3, $$!8!(`PLDH&!0  L!@HD+P8, $<!`YhE$E$!0ΐ$Xt%h͠!Xbp !M$pY!X f%`Sl g1~!(|4xtplhd`\X'/{?'$$H,<'!'TPLHD@<840h!*@!<R&!!7!#&N /l!8!@< <!ُ$0._+L( <;~5+!8<< < <$@ P $6&$Ȃ@X%c$Ȃ$> $+$Ȃ 8<7+X`0 <`$3!0ˌߐ!y˓$ $Ȃ`$Ȃ@<H<$@0%+ ` <h<X<$@%$0dX&%c$@0%$3$Xd0$+$%$f' !8$ <7+x <$@%p!` $ ,$"N$GC1!0_$Y!`$  $  1!8 1_$$ _$YC1!`c11`_$0N ${.%-<! d$HJ !8@~%f, 1l0 ^<$PQ+Rp(<Y87+X}8<<_ <X<Y$@ k%`!` $ $"& $,#1! D1_$?$ $0!0ːy1 _$  $ *$8#1!Ó0x_$w9 ${%h,L$d$XLh ȫ!0@~$!! 0^-0 T+U+`<9Yh<7XX<_$ȃ@%$Pd%$@ +_8<7+X" 05+#8ތ$@H$%#$Hd %0%$H$$H!`90$$ h!@!Xl$&(@$b@@%$$C@X$%b$XH`'! d$$]0F@D$$*0YB$DDc$$pC $!&!ȟ?$$*``!HIP%BH.x%,X1g^,]$d1V!X$b@0%$$C0$P@%$PF@'! d$$p!H !ȟ)$`b@ $+K*%$`CpG%$!!0_ٌ@$0(%$PC %H,j0@L@D`('@! !8%  @@+xX8ƃp(!h!@l<x <$@` <H %(+H ` <' h<X<3$@%($@Ph%(E-C$@<H<8<%$H@ %(e!C$<7+H  x<$C$ < $s $P@ %( C$$ ?dC$$H@ %($C$H!@ $P&(M$$P3!@ !H!PI$&$P3%(E@dC$$H@@ %( $* $s!#h!@I$`dC$$H@@ %( $$ $$"&3!hf_1V_$$p$${%1!  1{  $p_$B $x$$d~N$-h!X!P C<h <$Pg(,Ǝ>$(Ŏ06!0$D$!!x$p%#N!%x8~ #pN D$!!x$p%?!p؎!Y$&!!xD$%C$!!PY$ %#D!_8%P V*# D '!@u+w `<hLp ^p!Z `|p/ npS&+&j ЎP/ zL|P(Tt p/]t p/ep  H/o H`/tX  h/ `/* p/h$ /'p8# ؓ/8H4 xP/!FpX˄B Ȕ`/#Up#]Q (K/%ipA]he 0KX/'|p] x K/)p0kQ0nooolx0' l{    "((t1t:p @IX OX*!#%')+,-ajry$bionic/libc/regex/engine.cssteplstepsbackreflbackrefsslowsdissectlslowldissectsmatcher_gp_disp_ctype_memcmpmemsetmemcpystrlenfreemallocregexec  @ ` / """!!%1">"E"L"S"Z"a"h"o"v"}"""""""""""" "."<"J"X"f"t"""""""""""""*"?"R"`"o""""""""("@"N"\"j"x""""""" ""("6"D"R"`"{"""""""""4"`"l"""""""""$":"M"i"u"""  '09BKT_"{""""  09BKTbm"y } """"   "+ 0 "; V f k "  "    !  !     "   / 4 "? D "O T "_ d "o      "  "    " ! ", ; D H !^ b !x |    " " " " " "( "4 "J "[ _ c p y          ! ! % 8 H L b f !|    ! !      " 27"BG"RW"bg""""""4"P"\"h"t"""""#,M[duy!!! &*!T!]fy""""")8HM"X]"i"ty""""" ""$)"3@es""!!!@!Naqu!!!!#37!MQgk!!!$!<ENfj!!!! !2BF\`vz!!!!(8<PT!t!!! !G!Uhx|!!!!=!FObrv""""""1"<"I"TX\e"ot"~"""!!/3!W!`r{!!"&<@VZpt!!!!"+4GKuy!!#'!Q!Zcv!!  # 5 9 !Y !b          !  !!!9!!B!K!Y!b!~!"!"!"   8 P G_'' (p       )l    '' (p    )l  ''p  ` ( ( (P \  ''P X ( 8  ''x *   (, )t + + ( (( @  ''P X ( 8  '' ) , -( - ( (x ( - - . .   (x 4** -'' d )t , .P * *   +T )T -d -| ( ( (8 +T +@ L h -x - - * ( (8 ( ) + + -  -0 -4 . . d  *4 P  ( ) + +$ < " (" (# # h# #$ $$ - DH tx DHx| H x H|    ! % , 0 7 ; B F U Y a e t x                           # ' . 2 9 = D H O S Z ^ e i p t {                             ! ( , 3 7 > B I M T X _ c j n u y                               % ) 0 4 ; ? F J Q U \ ` g k z ~                         $ ( / 3 B F N R a e m q x |                           # ' . 2 9 = D H O S b f m q x |                              ! ( , 3 7 > B I M T X _ c j n u y                         ' + 2 6 = A H L [ _ f j q u |                             " ) - 4 8 ? C J N U Y ` d k o v z                               !  *  .  6  :  C  G  O  S  \  `  h  l  u  y                             '  +  2  6  =  A  H  L  S  W  f  j  q  u  |                                   !  %  ,  0  7  ;  B  F  M  Q  X  \  c  g  v  z                                 $  3  7  >  B  Q  U  \  `  g  k  r  v  }                                    "  &  -  1  8  <  C  G  N  R  Y  ]  l  p  w  {                    ")-48?CJN]ahlsw~  $+/6:AELPW[bfmqx| #,08<EIQU^bjnw{ )-48?CJNUYhlsw~ #'.29=DHOSZ^eix| "&59@DSW^bimtx$(/3:>EIPT[_nry}&*9=DHQU]ajnvz &*15<@GKRV]ahlsw~ #'.29=DHOSZ^eipt{  $+/6:AELPW[bfmqx|$(/3:>EIPT[_fjqu| !%,07;BFMQX\cgnry} ")-48?CRV]ahlsw~  $+/6:AELPW[bfuy  #*.59@DKOVZaelpw{$(/3BFUY`dkovz &*15DHOSZ^eipt{      ! 0 4 ; ? F J Q U d h o s z ~                     !!!!!!$!(!/!3!:!>!E!I!X!\!c!g!n!r!y!}!!!!!!!!!!!!!!!!!!!!!!!" """""&"*"9"="D"H"O"S"Z"^"e"i"p"t"""""""""""""""""""""""######%#)#8#<#C#G#N#R#Y#]#d#h#o#s#z#~#################$$ $$$$!$%$,$0$7$;$B$F$M$Q$X$\$c$g$n$r$y$}$$$$$$$$$$$$$$$$$$$$% %%%%$%(%1%5%=%A%R%V%]%a%h%l%s%w%~%%%%%%%%%%%%%%%%%%%%%%%%&& &&&&#&'&.&2&9&=&D&H&O&S&Z&^&e&i&p&t&{&&&&&&&&&&&&&&&&&&&&&&&&&' '''' '$'+'/'6':'A'E'L'P'W'['b'f'm'q'x'|'''''''''''''''''''''''( ((($(((/(3(B(F(M(Q(Y(](d(h(o(s(z(~((((((((((((((((((((((())))))$)()/)3):)>)E)I)P)T)\)`)g)k)r)v)})))))))))))))))))))))))* * ****#***.*5*9*@*D*K*O*^*b*i*m*t*x**********************++ ++++"+)+-+4+8+?+C+J+N+U+Y+`+d+k+o+v+z+++++++++++++++++++++++,,,,(,,,3,7,>,B,I,M,T,X,_,c,j,n,u,y,,,,,,,,,,,,,,,,,,,,,,,,,------%-)-8-<-K-O-W-[-l-p-w-{---------------------. ....".).-.<.@.G.K.R.V.].a.h.l.s.w.~......................./ //// /$/+///6/:/A/E/L/P/_/c/j/n/u/y//////////////////////0 0 0000#0*0.05090@0D0K0O0V0Z0i0m0t0x000000000000000000000011 111&1*11151D1H1P1T1e1i1p1t1}11111111111111111111112 222#2'2.22292=2D2H2O2S2Z2^2e2i2p2t2{22222222222222222222222223 3333 3$3+3/363:3A3E3L3P3W3[3j3n3u3y333333333333333333334 4 4444#4*4.45494@4D4K4O4V4Z4a4e4l4p4w4{44444444444444444444444555555$5(5/535B5F5M5Q5X5\5k5o5v5z55555555555555555555555556 6666 6'6+62666=6A6H6L6S6W6^6b6i6m6u6y6666666666666666666666666777777%7)70747;7?7F7J7Q7U7\7`7g7k7r7v7}77777777777777777777777788 8888"8&8-81888<8C8G8N8R8Y8]8d8h8o8s8z8~8888888888888888888888889 9 9999#9*9.95999@9D9K9O9V9Z9a9e9l9p9w9{9999999999999999999999999: :::: :':+:2:6:=:A:H:L:S:W:^:b:i:m:t:x:::::::::::::::::::::::::;;;;;;$;(;/;3;:;>;E;I;P;T;[;_;f;j;q;u;|;;;;;;;;;;;;;;;;;;;;;;;;<< <<<<"<&<-<1<8<<<D<H<O<S<[<_<n<r<y<}<<<<<<<<<<<<<<<<<<<<<<<= =====&=*=1=5=<=@=G=K=R=V=]=a=h=l=s=w=~=======================> >>>> >$>+>/>6>:>A>E>L>P>W>[>b>f>m>q>x>|>>>>>>>>>>>>>>>>>>>>>>>>?? ????!?(?,?3?7?>?B?I?M?\?`?g?k?r?v?}??????????????????????@ @@@@ @'@+@2@6@=@A@H@L@S@W@^@b@i@m@t@x@@@@@@@@@@@@@@@@@@@@@@@@@AAAAAA$A(A/A3A:A>AEAIAPATAcAgAnArAAAAAAAAAAAAAAAAAAAAAAAAAB BBBBB&B*B1B5BDBDIDMDTDXD_DcDjDnDuDyDDDDDDDDDDDDDDDDDDDDDDDEE EEEE"E&E-E1E8ETETITPTTT[T_TfTjTqTuT|TTTTTTTTTTTTTTTTTTTTTTTTUUUUUU$U(U0U4U;U?UGUKURUVU]UaUhUlUsUwU~UUUUUUUUUUUUUUUUUUUUUUVV VVVV!V%V,V0V7V;VBVFVMVQVXV\VcVgVnVrVyV}VVVVVVVVVVVVVVVVVVVVVVVW WWWWW&W*W1W5WDWHWOWSWZW^WeWiWpWtW{WWWWWWWWWWWWWWWWWWWWWWWXX XXXX!X(X,X3X7X>XBXIXMXTXXX_XcXjXnXuXyXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYY%Y)Y0Y4Y;Y?YFYJYQYUY\Y`YgYkYrYvY}YYYYYYYYYYYYYYYYYYYYYYYYZZ ZZZZ"Z&Z-Z1Z8Z^E^I^P^T^[^_^f^j^q^u^|^^^^^^^^^^^^^^^^^^^^^^^^__ ____!_%_,_0_7_;_B_F_M_Q_X_\_c_g_n_r_y_}________________________`` ````"`)`-`4`8`?`C`J`N`U`Y```d`k`o`v`z`````````````````````````a aaaaa&a*a1a5amEmImPmTm_mnmrmym}mmmmmmmmmmmmmmmmmmmmmmm nnnn#n'n.n2n9n=nDnHnOnSnZn^neninpntn{nnnnnnnnnnnnnnnnnnnnnnnnno oooo o$o+o/o6o:oAoEoLoPoWobofomoqoxo|ooooooooooooooooooooooopppppp%p)p0p4p;p?pFpJpQpUp\p`pgpkprpvp}pppppppppppppppppppppppq q qqqq#q*q.q=qAqHqLqSqWqfqjqqquq|qqqqqqqqqqqqqqqqqqqqqqqqrrrrr"r1r5rsBsIsMs\s`sgsksrsvssssssssssssssssssssssst tttt t't+t2t6t=tAtHtLtStWt^tbtitmtttxtttttttttttttttttttttttttuuuuuu$u(u/u3u:u>uEuIuPuTu_ufujuquuu|uuuuuuuuuuuuuuuuuuuuuuv vvv#v'v.v2v9v=vDvHvOvSvZv^vevivpvtv{vvvvvvvvvvvvvvvvvvvvvvwwwwww%w)w0w4w;w?wFwJwQwUw\w`wgwkwzw~wwwwwwwwwwwwwwwwwwwwwxxxxxx$x(x/x3x:x>xExIxPxTx_xnxrxxxxxxxxxxxxxxxxxxxxxxxyy yyyy#y'y.y2y9y=yDyHyOySyZy^yeyiypyty{yyyyyyyyyyyyyyyyyyyyyy zzzz"z&z-z1z8z~B~I~M~T~X~_~c~j~n~u~y~~~~~~~~~~~~~~~~~~~~~~~~~%)04;?FJQU\`gkrv} "&-18<CGNRY]dhosz~ǀˀҀր݀  #*.59@DKOVZaelpw{āȁρӁځށ  '+26=AHLSW^bimtxł̂Ђׂۂ$(/3:>EIPT[_fjqu|ƒɃ̓ԃ؃߃ !%,07;BFUY`dkovz   (08@HPX        ( , 0 4 @DHLPTX\hlpt  $(,8<@DHLPTX\`dptx|  $(,048<HLPT`dhlptx|  $048<@DHLPTX\`dhlptx|  $(,04@DHLPTX\`dhlptx|  $(,048<HLPTX\`dhlptx| (,048<HLPTX\`dhlptx|  $(,8<@DHLX\`dhlx| (,048<@DHLPT`dhlptx|       $ ( , 0 4 8 < H L P T X \ ` d h l x |                                  $ ( , 0 4 8 < H L P T X \ ` d h l p t                                     ( , 0 4 8 < @ D P T X \ ` d h l x |                                     ( , 0 4 8 < @ D H L P T X \ h l p t x |                                  $ 0 4 8 < @ D H L P T X \ h l p t x |                           regfree.o/ 1331265337 1002 1002 100644 5172 ` ELF P4(!| % RU$ > : ; I$ > $ >  I&I : ;  : ; I8  : ;  : ; I : ; I8 I!I/ .? : ; ' @: ; I4: ; I^int;w<PwX0 1)# 20# 3# 4# T4 )# q# O)# 8)# # ## 1)# ># ># }>#$ )#( g)#, l)#0 D)#4 #8 1#< b)#@ ]0#D )#H >#L #P5 uch*I sop>s+?li ptrj# jk(# ?l(# om0# n# (oI6yI3 f 1  g3>7  bionic/libc/regexbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includeregfree.cregex.hregex2.hstddef.hutils.h1qKAGM󻻻<'!'e4b ' E4@ ! @  < !   ' | P H | P H hTtxT,4`@`regfreere_nsubfirststatere_magicsize_tsetbitssopnomustcat_tshort unsigned intcsetsizecharnsubmlennbolneolstripfloatlaststateregex_tre_glong unsigned intcategoriesbionic/libc/regex/regfree.cunsigned chardoublecatspaceregfreere_endpcsetunsigned intnplusmultislong long unsigned intcflagsncsetshashncategorieslong long intGNU C 4.4.3masksmultisshort intre_gutspregsetslong intnstates/u/raghu/ics_feb29signed charbackrefsmagiciflagsGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.regfree.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 l>xLpx^pXZ t npk;j T ~z \8 p|, , p\ `p0 pN  pn $p0~0W oi y   83    %.bionic/libc/regex/regfree.cregfree_gp_dispfree !%1>ELSZahov} )7ESao} ?`n|      d |            $ + / > B I M    bionic_clone.o/ 1331265337 1002 1002 100644 5352 ` ELF P4(# 8 % RU$ > $ >   $ > : ; I' I I  I .? : ; ' I@ : ; I : ; I4: ; I 4: ; I4: ; I.? : ; ' @nint*8\J(}f)  :)[ fn: 8:> D:)\ arg:B<(G=[>?[ret@) )3< fn3 arg3%ret5) bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic_clone.cstdarg.h: twJ JIKy Jt3tKI<'!'4 Lp^pZ `! np!#j ! ~Dz ! < !p$@ 8 !d@ X!p8 h@!p5 !p( !p9  !p0QU0$o4t" $c   # )2A<Vbionic/libc/bionic/bionic_clone.cclone_gp_disp__bionic_clone__bionic_clone_entry_exit_thread  !%3:AHOV]dkry       #- 2< AK cj n r     l ,   , 0  0      $ + / > B I M \ ` g k r v                     % )       __get_tls.o/ 1331265337 1002 1002 100644 2644 ` ELFP4( % RU.? : ; ' I@ 4: ; I  R )S StlsSSV? bionic/libc/arch-mips/bionic__get_tls.cP;|!` |  |   V)__get_tls __get_tlsGNU C 4.4.3/u/raghu/ics_feb29bionic/libc/arch-mips/bionic/__get_tls.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__get_tls.rel.debug_frame.rel.eh_frame.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxE^pVZ H npZj  zp p|     $ p  , p  4 p D p0 R0^op8P  4   *  bionic/libc/arch-mips/bionic/__get_tls.c__get_tls !%+6 : L       __set_tls.o/ 1331265337 1002 1002 100644 3304 ` ELFP4(!% RU$ > $ >  $ > .? : ; ' I@ : ; Ie;intNv)q )ptr }U? bionic/libc/arch-mips/bionic__set_tls.c  <'!  |   |   T__set_tlslong long intunsigned intunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3charlong intdouble__set_tlsshort unsigned intsigned charbionic/libc/arch-mips/bionic/__set_tls.cfloatshort intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__set_tls.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxb^pZ  npYj x  ~z  p     p@ pS  ps  p p00 o   p O   * 4=bionic/libc/arch-mips/bionic/__set_tls.c__set_tls_gp_disp__set_thread_area !%3:AHOV]dkry   L          cacheflush.o/ 1331265337 1002 1002 100644 3716 ` ELFP4(!| % RU$ > $ > $ > .? : ; ' I@: ; I: ; I4: ; I? < Tint!.gB)D a end a3< aF0~0{` bionic/libc/arch-mips/bionicbionic/libc/includecacheflush.cunistd.h u#<'!'*0! (f#( $! ' | DP D | DP DD 4T ,U VcacheflushDDlong long intshort unsigned intunsigned intunsigned charflagslong unsigned int/u/raghu/ics_feb29long long unsigned int__page_shiftGNU C 4.4.3charstartlong intdoublebionic/libc/arch-mips/bionic/cacheflush.csigned char__page_sizefloatshort intcacheflushGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.cacheflush.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx}^pZ  npj  ~dDz  p( ( pY PpQ! \pr  dp tp00 o    L   +8D Cbionic/libc/arch-mips/bionic/cacheflush.c_flush_cachecacheflush_gp_disp !%3:AHOV]dkry      m $         $ 3 7 F J    mips_strlen.o/ 1331265337 1002 1002 100644 4516 ` ELFP4( % RU : ;  : ; I 8 $ > : ; I : ;  : ; I.? : ; ' I@  : ; I 4: ; I  4: ; I U$ >  I&8t\W7vB08v#B18v#B28v#B38v#+?9)JvKvbL}FM83-- _a34 cnt5-) x6v @t RTv oUv bxnint:V bionic/libc/arch-mips/stringmips_strlen.cmips-string-ops.h8¼JN(KKtKtKtKtKtyJtKtKyK"yg0@0f@0`Up$B$ <5'P!Xf <$@K%5$8C!f'x$p$h_I$2$B$ !f'$x8$pF!@f'P$H $8%A!pf'h$`$X<`!8f'$$x7!@f'X$P $HE2  !xf'p$h$`- $!@f'H$8 $(  B$!hf'`$X$Pe@B$d020B$B$#3X$ @$$B$B$B$B$B$B$B$B$!  |   |  xTTTRtRRRRRRRRRRDSSSxT<strlentbionic/libc/arch-mips/string/mips_strlen.cunsigned intstrlenbits_tbitfields_t_01sbits/u/raghu/ics_feb29_80sGNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strlen.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 d>xLpx^pS<Z l npj  zp  $  4p < p \p  dp( t0p00o ` 03   , bionic/libc/arch-mips/string/mips_strlen.cstrlen !%*y~        ' c          ) - 4 8 ? C J N U Y ` d k o v z                      bcopy.o/ 1331265337 1002 1002 100644 5372 ` ELF P4( % RU$ > : ; I$ > .? : ; ' @ : ; I4: ; I : ;  I &  &I+Kint;kB<;;&;4;0sdst?src@3tA0fz   7  V bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebcopy.cstddef.h Zt(KLyKHt;<Et=Yh1!/!+8.%H(1]&b0@!,_@0!!8!0!!x!hB$b!! ! !@@!(`$%$ !d!DE$eB$c$! !(%800 0&H(1!P,+@0!P!!0!@!8!@% $c$`#P ! !(!@!8!% $c$`쬀h#0 !(! @$$B$000#b00 $#l#000 |   |  TTTTUUUUUPVVVVVVStUtSUSU@W@TUTxWxURpTpRXRT<X<TTT|X|THLSLPWPlVltStVTVW Z RVHSHTVTSRVVZVSVIbcopysize_tlengthsrc0/u/raghu/ics_feb29dst0GNU C 4.4.3charbcopylong intbionic/libc/string/bcopy.cdoneunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.bcopy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 t>xLpx^p Z | npZj 4 zLp   <@  Lp` Tp p  p4 p0Dx0o` P"    bionic/libc/string/bcopy.cbcopy !%1>EKR V bl q{               ! % 4 8 ? C J N U Y ` d s w ~                             $ 3 7 > B I M T X _ c j n u y                             " & - 1 8 < C G N R Y ] d h o s z ~      memmove.o/ 1331265337 1002 1002 100644 4104 ` ELF P4(!(% RU$ > : ; I$ >  $ >  I.? : ; ' I@ : ; I 4: ; I & &IvLint;,_:*x dst srcT n0r p! q"   bionic/libc/string/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/includememmove.cstddef.hstring.h yEOOE?<'!'$!8!+ !$! @!0` ('!H+@I!  !(@$(' | xP(D | xP(Dx( $T$DRD`R`hR DUD`U ,V,DSDTSThVmemmovexxmemmovesize_tbionic/libc/string/memmove.cunsigned charlong unsigned int/u/raghu/ics_feb29long long unsigned intGNU C 4.4.3charlong intdoublelong long intshort unsigned intsigned charfloatshort intunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.memmove.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p Z  npj  ~4xz ( p( ( p p p  p p00o4    <   x &/6bionic/libc/string/memmove.cmemmove_gp_dispmemcpybcopy !%1>ELSZahov}       , P T         $ + / 6 : A E T X _ c r v }         memcmp.o/ 1331265337 1002 1002 100644 3944 ` ELF<P4( % RU$ > : ; I$ > .? : ; ' I@ : ; I4: ; I4: ; I  I & &I4@int;\()s1s2n0<p1 O/!Vp2"xd#)   c bionic/libc/stringbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includememcmp.cstring.hstddef.hO(HLLv s!0+?@#g8@$+@&5#j0@$+`f-'@#PI%!8# xph $!Hn!@m! dhl#@inc$#@+8f $x#@dg#@! |   |  xTT|UUV$DYDSY|U`RRRBmemcmpsize_tunsigned charmemcmp/u/raghu/ics_feb29end1GNU C 4.4.3bionic/libc/string/memcmp.cunsigned intGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.memcmp.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^p Z  npgj ` zLp\  h|  xp pP @pm  Hp Xp0i0o(< `  $    bionic/libc/string/memcmp.cmemcmp !%1>DO S h v              " ) - < @ O S Z ^ e i x |          strcmp.o/ 1331265337 1002 1002 100644 3064 ` ELFtP4( |% RU$ > $ > .? : ; ' I@ : ; I : ; I I&I}H5int)5)<ns1-nTs2-nty0tR bionic/libc/stringbionic/libc/includestrcmp.cstring.h.=!(C$@$# |  < |  <U V U0V4<U7strcmp<<bionic/libc/string/strcmp.cunsigned intstrcmpchar/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strcmp.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpxs^pZ ` nplxj `  z<p   h @  x p`? Pp p  p p0T0@oRbt `  $   < bionic/libc/string/strcmp.cstrcmp !%39D H i |_          ! % , 0    strcpy.o/ 1331265337 1002 1002 100644 3048 ` ELFP4( |% RU$ > $ > .? : ; ' I@ : ; I: ; I 4: ; I I &IM:int 6z0zto#z#U5%zY R bionic/libc/stringbionic/libc/includestrcpy.cstring.h&<JJJ!`!$c$f |  0 |  0T0S7strcpy00unsigned intstrcpyfrombionic/libc/string/strcpy.csave/u/raghu/ics_feb29GNU C 4.4.3charGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strcpy.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5  >xLpx^pZ  p npj  z0pD  d  p p p  p p0^0Mo_o `  $   0 bionic/libc/string/strcpy.cstrcpy !%39D H ] bo_           strncmp.o/ 1331265337 1002 1002 100644 3296 ` ELFXP4( % RU$ > : ; I$ > .? : ; ' I@ : ; I : ; I I &IQ!>int ;H)Ls1'Ts2'n'0  bionic/libc/stringbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includestrncmp.cstring.hstddef.h(fH} !0$$C@$!# |  L |  LU4<UV4<VBstrncmpLLunsigned intsize_tstrncmpcharbionic/libc/string/strncmp.c/u/raghu/ics_feb29GNU C 4.4.3GCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.strncmp.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pZ p npj X  zLp  `   p p<< x @px p  p p0]0#o5EX `  &   L bionic/libc/string/strncmp.cstrncmp !%1>DO S t           " ) -    /600 1331265337 1002 1002 100644 7476 ` ELFP4(*'|(0((% RU$ > $ > $ > '  : ;  : ; I8 5I : ; I  : ;   I .? : ; @ 4: ; I.? : ;' I@: ; I4: ; I4: ; I =b0Bint$T n)s*#) +%y%#%# U$%#' #( # ) #   +O+#+# &.xw 0 )3j Sj j l ^Zt \ yJt L!+&[ bionic/libc/bionicbionic/libc/includepthread-atfork.cpthread.h. BI$KMFNKIKtt J8胼IK 胼IK <'!'$  $1&0 $  $ ('<'!',($ ! $!@@ED&P  Fb$De"$D& Q,!($ 0', $($ 0'q<'!'$ 01&   $ $ ('<'!'$ 01&    $ $ ('@ | xP(LP0PtP(LtP(L | xP(L4P0PTtP(LttP(Lx(@p`0 4T4``` ,U\lU 0VdlVt((h`t((h`~AO__bionic_atfork_run_preparewpthread_atfork__bionic_atfork_run_parent__bionic_atfork_run_child4xttxttprepareatfork_head_tpthread_mutex_t__bionic_atfork_run_prepare/u/raghu/ics_feb29atfork_t__bionic_atfork_run_parent__bionic_atfork_run_childentryfloatchildcqh_firstunsigned charlong unsigned intparentshort unsigned intcqe_prevdoublecursorunsigned intlong long unsigned intsigned charbionic/libc/bionic/pthread-atfork.clong long intGNU C 4.4.3charvaluecqe_nextshort intpthread_atforklong intatfork_headentrieshandler_mutexcqh_lastGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__bionic_atfork_run_prepare.rel.text.pthread_atfork.rel.text.__bionic_atfork_run_parent.rel.text.__bionic_atfork_run_child.data.handler_mutex.rel.data.rel.local.atfork_head.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5  (>Lp^pAZ ( npj  ( ~xz 8( h 4`(Ht H(t H(04 $(:p<6 4@(KG t (Yp\)U 0(hp d (|p 8x (( p? ( @("p0g 06 oH X @)    %3 "$%&?x [dwttbionic/libc/bionic/pthread-atfork.chandler_mutexatfork_head__bionic_atfork_run_prepare_gp_disppthread_mutex_lockpthread_atforkmallocpthread_mutex_unlock__bionic_atfork_run_parent__bionic_atfork_run_child @"`# !%3:AHOV]dkry '3AQW [ _hry    +0<h   $  ,4 8$ T \p t| !P  $(X !T 0 h $(X !T 0 h 48 TX tx 8 X x     $ 3 7 ? C S W ^ b i m t x                  (      /618 1331265337 1002 1002 100644 18820 ` ELF(P4(52(((00 0% RU$ > $ >  $ > : ; I : ;  : ; I8  : ;  5I I !I/ .: ; ' : ; I I.: ; ' I .: ; ' I .? : ; ' I@ : ; I .? : ; ' I@: ;I4: ;I : ;1RUX Y11X Y1X Y4: ;I1RUX Y1RUX Y: ; I 4: ; I!1RUX Y "1RUX Y #&I$4: ; I% : ; &1RUX Y '1X Y (4: ; I)4: ; I *&Ib`intAM#o`.3a:d#xa# )F*# )+ ?F@#`AMaNaM) (## )#)# 7)#)#L# } O2 gA)) g)%)4g))^HF^T') HO^T)(HX^TX)U1)(Hg^TgU)) g7 ret9)_X@@Ue|IO) g)ret)8 D8).ngN ret)!8P" Dh()D"gs")Tret)}1tH!T"*(#)^g)T gs"9$)x ret)%!H& T(' ()6g)xng(ret)n)L1gpQHp$>r$s)th)Uul retv)*'L bionic/libc/bionicbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxbionic/libc/includepthread-rwlocks.cposix_types.htypes.htime.hpthread.hL~~}KK煽Jlt"aJJ^<~t~~JJOouJtJ J~JJ4MKt1wJ JvJ JK<1,M~JJ$u jJJw ,M~JJLHuo(J~ IKx$xIJt= GKKNh<?=z<dJJvt!$$!$,@$!!$<'!'$ "!  @$ ! $!  ('  B$@` &!$$!  ('!  D$$ <'!'$ !  ` B  Dc$$ ! $!  ('c$ !$$!  ('<'!'$ !   ` B$ ! $!  ('  `!$$$!  ('C<'!',($ !1!  ` Qf$ ! ! ,!($ 0' "&%! `!( !0@@!@` I% ,$!($ 0'$ $ <'! !(<'!',($ !3!  2` R&$! `!( !0 -@!@ @B! ` j%  !(% ! ,!($ 0',$!($ 0' @B $<'! !(<'!'!@$ ' $ ! ! '$<'!',($ <!$"b!!( ! @!@,!@($ 0'!(  &)@!@,!@ ($ 0'' ! @$ ! @' ! $ ! !(@,$!@($ 0' ! , |   ( ( P(LP(LP(L$DP0X $TP0X xP HLP0P |   $ 4( D(T P(LtP(LP(L$DP0X $TP0X $xP H@LP0P ( 4T4``h`T `D\aaaa( 4T4``TLpRRd|aaa( 4T4t`|`T`XpaaaD0 DTD`` T D` 8U8bb U Db\aa DadtRtdRdRd DR TT0 DTD`(T(T` 8U8aa(U(Ta\b(TbtdRddDTR Tx DTDh`pxTL0 HTHt`|`T`8T8L` HUU8UHTUUDpa|a8LaXlb|RbRb (b8DRDLb 4pthread_rwlockattr_initdpthread_rwlockattr_destroypthread_rwlockattr_setpsharedpthread_rwlockattr_getpsharedpthread_rwlock_unlockpthread_rwlock_trywrlock pthread_rwlock_tryrdlocknpthread_rwlock_timedwrlock1pthread_rwlock_wrlock^pthread_rwlock_timedrdlock pthread_rwlock_rdlock6pthread_rwlock_destroynpthread_rwlock_init| (( DTxL@D 8DHLDHLd8DHLDH|LXHTX\TX\d0DHTX\TX(D\d (( DTxLpendingWriters_pthread_rwlock_pulseread_preconditionpendingReadersvaluereservedcond_attr0pthread_cond_tlong inttv_nsecpthread_rwlockattr_initpthread_rwlock_timedrdlocktimespecpthread_rwlock_tryrdlockpthread_rwlock_unlockpthread_rwlock_timedwrlockfloatnumLockspthread_rwlock_trywrlock__kernel_time_tlock_attrattrshort unsigned intdoublerwlockpthread_rwlock_initlong unsigned intpthread_rwlock_destroypthread_rwlockattr_destroylock_attr0cond_attrpthread_rwlockattr_setpsharedunsigned charunsigned intwriterThreadIdlong long unsigned inttime_tsigned charpthread_rwlockattr_tbionic/libc/bionic/pthread-rwlocks.cwrite_preconditiontv_seclong long intGNU C 4.4.3charpthread_mutexattr_tcondEXITshort intpthread_mutex_t__get_thread_idpthread_condattr_tpthread_rwlock_rdlockpthread_rwlockattr_getpsharedpthread_rwlock_t/u/raghu/ics_feb29abs_timeoutpthread_rwlock_wrlockpsharedlockthread_idGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.pthread_rwlockattr_init.text.pthread_rwlockattr_destroy.text.pthread_rwlockattr_setpshared.text.pthread_rwlockattr_getpshared.rel.text.pthread_rwlock_unlock.rel.text.pthread_rwlock_trywrlock.rel.text.pthread_rwlock_tryrdlock.rel.text.pthread_rwlock_timedwrlock.rel.text.pthread_rwlock_wrlock.rel.text.pthread_rwlock_timedrdlock.rel.text.pthread_rwlock_rdlock.rel.text.pthread_rwlock_destroy.rel.text.pthread_rwlock_init.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X5 $7h3>LpM^pE Z 7p3 npP Pj <h3 z ((,  d=83%8! =(3HD =(3kDg =83 $>3T <>83h t>3x > 3L >H3!4pD\0 >3#E\A ?h3%SpvO ,@3'bpr^ F3)vpr Fp3+p|  $G`3-p0"0%o%%04! 4   !#%')+-/01& > Y(w( 2DMdzTxL!+=Zpbionic/libc/bionic/pthread-rwlocks.cpthread_rwlockattr_initpthread_rwlockattr_destroypthread_rwlockattr_setpsharedpthread_rwlockattr_getpsharedpthread_rwlock_unlock_gp_disppthread_mutex_lockpthread_mutex_unlockpthread_cond_broadcast__get_threadpthread_rwlock_trywrlockpthread_rwlock_tryrdlockpthread_rwlock_timedwrlockpthread_cond_timedwaitpthread_rwlock_wrlockpthread_rwlock_timedrdlockpthread_rwlock_rdlockpthread_rwlock_destroypthread_cond_destroypthread_mutex_destroypthread_rwlock_initpthread_mutexattr_initpthread_mutex_initpthread_cond_initpthread_mutexattr_setpsharedpthread_condattr_initpthread_condattr_setpshared! "@#`$%+,-/ 0@1`25 !%3:AHOV]dkry(;IWes )6A E Qfq u        +;@G P Tj n    '1@IMX\p{ )3>BNY`kos| '18CGKT^p{   % @ hy&&( 'D ( ) ) *&&( '8 *d (&&( '8 *X (&&8 'H *t ( .8 .&& -&&8 'H *t . . (&& 0&&@ 3P 4&&< 6H 7| 8 9 : ;8 4 $( 48 DH TX tx$(@D ( 8 H X x(D     $ + / 6 : A E L P _ c j n u y    .2:>NRY]dhosz~ $+/6:AETX_cjn} &*9=DHOSZ^eix| "15=AQU\`gkrv}!%,07;BFMQX\cg   ( 0 8@HPX`hp      $(,8<@DPTX\hlptx|    $ ( , 0 4 8 < @DHLPTX\`dhlptx|/637 1331265337 1002 1002 100644 27684 ` ELF?P4(30 ((X@@(?@p% RU$ > : ; I$ >  $ >  : ;  : ; I8  : ;  : ; I  : ;  '  I I : ; I!I/ 5I : ; I8  : ; 5I.: ; ' : ; I4: ; I.: ; ' I .: ; ' I : ; I4: ; I.: ;' : ;I&I : ;I!4: ;I" #4: ;I$.: ; ' @%1X Y &1' (41 ).: ;' I@*: ;I+4: ;I,1RUX Y-1RUX Y. U/410411.? : ; ' I@21RUX Y31X Y4: ;I54: ;I 64: ;I 71X Y8.? : ;' @91X Y: U;4: ; I HintA;m\3)4;v"W2y4^5iX3!7) 8) 77di+##K/Tv0#1#  w  )   T  ʧ ˳# ̞#  w4    l ) K ͂)  @ 8 w# )#X )# ι#  )O *O#) +8  ?v @O# A_  D E# F# G0#> H0#  I# J# Ko QVTV^#id_#`#fa# b#c#(dw#,RiT#0*jv#4qkO#8lO#<m##@n##HoO#P]WB WuT#v#w,#Y[</~]t~]nn)]t]id)E;)t!t!9N)aN ?2a?2b?\)Sa\7IjaI2 ) 4!"#now+5a52b5S)aSbS.t]*)nn)")Tt]),vt])$/%<@&I'@(RR) F*id@+]i+),c -pH&&&.0/01e )*id.H+) +D)@2l`&3Xl&1J )8^p *id4)44p 4V.x+)Z5@6nowH2tr&2\&&74\&&7&2jX &&x.(P7 &'8(X2? &(&-8 &I3&v K+8{T 4*).8+ ]2hP  & &.h/ .0!9cHh 1 )\ *id@4Vi.+)2t &2j &&x.(X:  (`288 &I-P&(&3&-p&1 ~)` *id{.+]F!)2pl &&&./o09cHl7  &38D&1 }) 4/3*evp3 43 7:C 5@X.+I]v+)J!K2.J &?.(0H9cI3T(`o&j&a)hP4!)2<@% &:`5!5"6now#7ox &2tm &2T_ &2HS &(&7L &&2O &&7H#&23B&&7(\&:0#ret8)59@-\`:&(&-P`&&7v&-T|&j&a;O;I] bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxbionic/libc/kernel/common/asm-genericpthread-timers.cpthread_internal.hstddef.h_types.hstdint.hposix_types.htypes.htime.hsiginfo.hpthread.htime.hu?IKJKKIjJjJuRJt( 4Dp?~B~Jvt=4%a(=}?~}<|J|KIKHLKJ~J~JJ~J|}J}JILly| 8rJ>MGOrLKIKx $,, x=~>~~J}}IKJ}J~J~|$Jh~R=J~t (HLutKIK~0<$ IJKrLLHHLIM4>KMFKKLKK~NK~NGMzKF=3~JLFLHMKc~tt$~<~J~J}J~JJuJ JcJyJQ||t|JaJKIJ|J|lK hKKJJ}JJ}}J~J|JJ|JLHHMK{4iB||KILJ|JIJ|JJ|<khK<{Jy J<'!'$  $!@"P! !(  $!  !(!$ $!TB$D e&!$ $Xa#HP #@I%!(B$eFTc$ '<'!'$ !$ $Q !$! ('<4$ .` ! i`#X#p!P0 I$(&!. ! $!<'!'$ $  ('Y$ @!@0Q$ ! ! P $! (' $$C$<'!'TPLHD@<8!!! TPLHD@<8X' $C$Y$ @!@0V$ !  @tDu(,<!; "4HhLg('  !d  'B2@$; xLpx^pZ ELSZ_jw~,8FUalx*AUhw '5CQ_m{$=dq 9Tky "/IUkw~          1:HSW[nsx!&+6;]aw{  % ) D H ] a w                     1 6 A F K V _ c y }            # ' + > C H S X h l                 & + 4 D I T Y d i y }               & / ? c g }          (,GK]r  \ R/$$ %4 <@ &\ '$$, ( 0 ( 8@ D ) *$$$ ,< @ X )p * -$$H /| -  ) 0 0t * 1 0$$8 <P (H TL \ dh ) ) 1 * *$$8 4d -  ) 0 *$$, 6P (H TL \ d h ) - * )$ 18 *L *$$@ 8 8 0 (    ) *` 9| ' : ;  - $( )< *` -x < * - -$$< )t * 0 = 0t * ) * )  *l > = > * 04 PTpt@D 4 TtD     $ , 0 @ D K O V Z i m t x            "&-1@DKO^bjn &*15<@GKZ^eipt{ #+/@DKOVZimtx!(,37FJQU\`osz~$(7;BFMQX\cgvz   (08@HP       $ 0 4 8 < HLPT`dhlx|  $(,8<@DPTX\hlpt  $(,8<@DPTX\`dptx|(,04@DHLPT`dhlptx| $048<@DHLPT`dhlptx|     ptrace.o/ 1331265337 1002 1002 100644 4540 ` ELFP4("(% RU$ > $ >  $ > : ; I.? : ; ' @ : ; I .? : ; ' I@ : ; I : ; I  4: ; I4: ; I</]int! pK")HBBT )a\ !) pid!> !}\ !}z (@ (aret)a bionic/libc/bionicbionic/libc/kernel/arch-mips/asmbionic/libc/include/sysptrace.cposix_types.htypes.hptrace.h!uy<'!'$$b,@ '@ $('$ |  \P(D |  $\P(D\( 0T@HT 0U@HU 0V@HV (W@HW8@pHTp2@_thread_created_hookptrace$\\long long intpid_tunsigned intunsigned charbionic/libc/bionic/ptrace.clong unsigned int/u/raghu/ics_feb29long long unsigned intaddrGNU C 4.4.3datalong intrequest__kernel_pid_tdoubleptraceshort unsigned intsigned charwordfloat_thread_created_hookshort intthread_idcharGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text._thread_created_hook.rel.text.ptrace.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X@5  >Lp^pa@Z ,8 npj d zhp\ t p8  8  p<  p6 | p*(  pR   p0j#0!o10 ! K    2\9Bbionic/libc/bionic/ptrace.c_thread_created_hookptrace_gp_disp__ptrace  !%3:AHOV]dkry           $.   $   $ (  (      $ + / > B I M \ ` g k z ~             /655 1331264894 1002 1002 100644 5564 ` ELF P4(!?0% RU$ > : ; I$ >  $ >  : ;  : ; I8 I !I/  I &I .? : ; ' I@: ; I: ; I4: ; I 4: ; I4: ; I' II4: ; I? < D8int ;[Kx/8{W!;S^q4W###q#G### #$:#(O#*#,#.|#0#2 I - ?L##ת#ت# C#?# #i#d"##$#%%#&#   ? h6)cb6( 7>%9Jh:.Q_;4)""0 J   ?'3tD bionic/libc/arch-mips/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/kernel/arch-mips/asmbionic/libc/kernel/common/linuxdl_iterate_phdr_static.cstddef.htypes.helf.h7vHQ JwILHLIGN<'!',!ȀC$dF$,0'HE$L $JIF $L',M!F!0 $$ , | P0D | P0D0 (T(i |U4R@pR"Hdl_iterate_phdrdlpi_namesize_t__u16e_machine__u32__executable_starte_ehsizep_fileszp_typeElf32_AddrElf32_Halfp_aligne_versionfloatdatap_paddrunsigned chardlpi_addrbionic/libc/arch-mips/bionic/dl_iterate_phdr_static.ce_shstrndxlong unsigned inte_shoffshort unsigned intp_offsete_phnumdl_infoElf32_Ehdrdoublep_memsze_entrye_phentsizeunsigned intdl_iterate_phdrlong long unsigned intehdre_phoffe_typeelf32_phdrdlpi_phnume_shentsizelong long intGNU C 4.4.3charp_vaddrElf32_PhdrElf32_Offshort intp_flagse_flagself32_hdrdlpi_phdrlong int/u/raghu/ics_feb29signed chare_identphdrdl_phdr_infoElf32_Worde_shnumGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.dl_iterate_phdr.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 >xLpx^pHZ   npxj  ~Hz  p( ( p,o $pp& p  p p00u o    `c   7 GPbionic/libc/arch-mips/bionic/dl_iterate_phdr_static.cdl_iterate_phdr_gp_disp__executable_start !%1>ELSZahov} )7ESao}#1@KWes      ;Q          $ + / > B Q U \ `    sysconf.o/ 1331264894 1002 1002 100644 11588 ` ELF0P4(&#0P% RU$ > $ > I!I/ $ >  I&I  : ; : ;I8 : ;I8 : ;I .: ;' I : ;I 4: ;I: ;I.: ;' 4: ;I.: ;' I@: ;I U1RUX Y11RUX Y41.? : ; ' I@: ; I1X Y 41 1X Y!4: ; I? < j0`int\$  % )# len)# U)# fd)# )# ")# }# }#  K>)\p>\retA)% )*)p*\c*) )p\cpc\ :l)npo*p)% ~)Ep*) )|pa l)paQh3pQ\ cU)b8(\ ~t10HUChNI)rvK)|,,}, %"}.87z}`~r E00W}c0(@n}!0!{0!M8!^9 E!: ^ bionic/libc/unistdbionic/libc/includesysconf.cunistd.hctype.h,sJKnJGJ?u<yJPh U=+GYJ*J,L~~JJJ~xlj0_-}LLKK~J>}}LLKKu<}LLKKJJ@~K}PFLKKJ>L~w<'!',($ !$$ $$*d#@!0 !(  $A Cr  ,$ !($ 0'@!0€e$@ J8I-  *Xl`Tn$!x!h,&($ 0'/proc/cpuinfoprocessor/proc/statcpu/proc/meminfoMemTotal: %ld kBMemFree: %ld kB<'!'LHD@<8d,@ Y$S$LHD@<8P'0%! !`L$HD@<8P'L$HD@<8P'< B6 $$$4<c$$$d$$ $ $,0% !(@(%t%''$!@ ! @! @!( !0`P(  $$$$$ $,0% !(@&3&(!'!@ ! ]@!@! !(` $@!@_$ /! $ $,0d% !(}@(R&s&!'! @!(`  $ & !@ ! @$*pM K@$? Lp^pL#Z (CHM<!"R[`hnv{bionic/libc/unistd/sysconf.cline_parser_gets$LC4$LC6$LC2$LC3$LC0$LC1$LC5_gp_dispread__errnoclosesysconfopensscanfmemcmp $ !%3:AHOV]dkry&2c#9FXo}    "+5@ D HQ[d h t x       * . : > PYb f     k    \ !x " # #  8 "4 p 0 %, L` l d p & # % $ , ( 0X ' %     '4 %0 Dd p h t &       $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |      <@  @      $ + / 6 : I M T X _ c r v ~                        $ ( 7 ; B F M Q ` d k o ~                  ( , 0 4 8 < H L P T X \ h l p t x |                             ( , 0 4 @ D H L P T ` d h l __errno.o/ 1331264894 1002 1002 100644 2840 ` ELFP4( % RU.? : ; ' I@  4: ; I I5I$ > $ > u:!0_ _4!qejintiR bionic/libc/bionicbionic/libc/include__errno.cerrno.hK;|b$ |  |   y)__errno __errnounsigned intGNU C 4.4.3/u/raghu/ics_feb29__valbionic/libc/bionic/__errno.cGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__errno.rel.debug_frame.rel.eh_frame.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 X >xLpxm^pyZ ` p np^mj  z p    pp  p>  p^  p0nW0o` 0 &     bionic/libc/bionic/__errno.c__errno !%+6 : F J OY t_       pthread.o/ 1331264895 1002 1002 100644 87228 ` ELFTP4((0(`8088(((`0 0(H80(8((0Ph(00?8% RU$ > : ; I$ >  $ > : ;I I  : ;  : ; I8  : ;  : ; I8 I!I/ ' ' II&I5I : ; ( '  : ; : ;I8  : ; : ;I8 .: ;' I : ;I.: ;' : ;I4: ;I &I!.: ;' "4: ;I#.: ; ' $: ; I% & '.: ; ' I (4: ; I) : ;*.? : ; ' I@ +4: ; I, -4: ; I..? : ; ' I@/: ; I0: ;I 1: ;I2.? : ;' @3: ;I44: ;I 5.? : ; ' I@ 6: ;I 74: ;I8.? : ;' I@ 9.? : ;' I@:4: ;I; : ;< U=.? : ; ' @ >: ; I?5@.1@A1B41C1X YD1E41F.: ;' @G1RUX YH4: ;I I1RUX YJ UK1RUX YL1X YM1X YN.? : ; ' @O1RUX Y P4: ; I Q 1R S41 T1RUX Y U&V4: ; IW4: ; I? < X4: ;I? < D&int8;  0T q   3) 4;,k    1IC 4i5t ")3J 8) 7GHd S # 0# j sigj# zK S)  )  *)#  )  *#)u + 1 b@   ?.  @# A  D ~ E# M F#  G0#  H0#  I#  J#r K9 M N P) Q  & &#j # #  < $ %# f &# '#  (# & ).#$ ^ *)#(  +#,  ,)#0 z -#4 tls .#88, /8D F8 G)#mapH8#IH# H X?wJJj)mjkeyj)X}pmpkeyp)0pX )$$ ; *)`ts$` f *!a  cmcT ~)m~0~"key)wmwkeyw)# $n #|$$n | "map"tlsn)%h ;&"kk))&l 0 # $n #$n '! p(n r'&$0$0( )u*  g+tls,- ;.@/ (-n F)* n)(0 T* q)<0 T1g )Y*= r)N0 NT0g UT* t) 0 T0 )U* u)0 NT0 U*% w) 0 T04 U * x)L 0 NT04L U*D z)( 0 T0 0U*> {) 0 NT0  U0* }) 0 T0U*$ ~)> 1 Nl0U*z )4 0 T0MU0 0V* ) 0 NT0MU0  V* )( 0 T00U* )> 0 NT0 U*8 )8 0T0 Un * )  0  T1 )*- ) 0 NT2 X@ 3c 1t!3arg"4n $R2( h 3c,71,)`n .5| * )  6oneT6twoU* ) 0  T* ) 2 0  T*5 )0 0 # T0 #U,(7X&)~ *m )< 0 1 T1 1)*] )L0 = T1# =)* )0A1 S 0# SU* )l0 9lT*+ )(0 BlT0# BU* )(0 KlT0# K)U*$ ) 0 XlT* )LJ0?rJT1 sP.V* ) 0?JT8 $3key,7 ;28 )("3tid[E0 ["U ](n ^ )8e0Tn 9 ) c011 Z 07 )#:ret)A;g`<n 4 0@"n:fd),<:_rc @9b )3howE)3setE&1E E9:retJ)L7J)zz9: )+3tid43sig4):ret6)77)9n 8*q )pv0]T1 ^ W7`)j. )11 )14 n 7):ret). )Tj1t1 14L 7)n :err)*V o)(0 T= <>tlsA/n T+nn)*e @) />ftx@/g/# @)z>val@)/@`5?] )@6ADBP*;)$>ftx;//# ;)>val;)*) ?J()~& . )=1?J]C$|DD,$|B<BEF9 G 0DC nDIL DD<BrQC 4XND  P "mRN" {"187n :4M;  <) =)RpQ!"cAI$J5"<0E2E>SJMy.!DJH"Bi$BtXargǩE>tlsc( )( (9/ )#3key3ptr#:err)"mapI Lp]#<E Myw#D,7 ;H#U9G )[$3key${1 "err"map:k)I $<E IT$DD<EI0i$DDDGdTPDDvGyhD9 )z%3key "err:thrU"map;iI l%%<E IdD%DDvMy^%DG4DDV V%%P:XP[TP^fP gPh4C4 L4^MXW[ ;W ;X  ) bionic/libc/bionic/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinebionic/libc/includebionic/libc/kernel/arch-mips/asmbionic/libc/include/sysbionic/libc/kernel/common/linuxpthread.cstddef.h_types.hstdint.hposix_types.htypes.htime.hsignal.hsched.hpthread.hpthread_internal.hunistd.hstdio.hMuL~NFNLL L L KL  HLKKIKLKL 0}u>LHKMHHMHMIKKGM  OK<sKIKLH L~ K K ~ LLH ~  KI~4N$]J#J_(= <$IKJJ$=CHLY,'Jb($|xHL?Mo=FNKmv J$Kww9Mp=GM(KM=GMzzJPENKKK $QwJLQs; c$OELMPbtBQyJQ&tiJJp v<K JvKIKIKLIKHLGKLIJKINQJH1JOJ1JJ6JKK8JGIHKKJK umnKL K_)WJ+JIFNK w<=IKyt LLI wIKIKHIM    $N}vIIKLO}tQ}JqJJ~JJ~<yM~~J~JyJJ~JJ"ZJ~w|yyJKRm(rHL(y|IK IKKI  $vJ JvJ JIK   sJ J~<{<$JztKIKI G9GJ'<jJj$KrJ JsJJrJ3EOM<3jJJEE$F$j<'!'$ !! ! ! !  ! !  ! @$ ! @ ('<'!',($$=b,@!,$!($0'$& DC$Cqh!`m $H $@* x$ $&,!($0';|!!C$$$Gf<'!',($! &C,`H$$!X $@ $JCa0 !d0I$8B$B$J$H %@!Xih&e ",!! ($0' &, $! ($0'$H$D$<'!'40,($ $=b, @!4$!0,($ 8' $&D9R$C!HT($$8h$ $&4!0,($ 8' &B @((K`8L! B@!pT؍&'x$h!Pͭ@ &!$$FE@ |  @P(D ( <     (    4  (  8 XP0DhP(H   0 < L 0  ( ( L $ ( ( P``P8LP0L pP8L P8T ( < P(P $P(PP(L0P`h  pP0PHP H dP0TP(P,$PHd P8LP0LpP(D P8P     P(P`P(P$P0L0XPPh  0Phh  P(PP0LP0L(P8\ |   $@P(D <( L< \ l |   (    4  (  ,8 < L\XP0DthP(H     0 < L 0  ( 0( @ PL ` p$ ( ( P``P8LP0L pP8L <P8T `( p<  P(P $P(PP(L0P`h  4pP0PTHP H pdP0TP(P,$PHd P8LP0L$pP(D <LP8P l |   P(P`P(P$P0L0 XPPh  0@Phh  tP(PP0LP0L(P8\@( T8@T(4R0UTU UX0 TDXT $UHXU $VPXVh( ,T,H`P`` $U@hU R((R(U4<U,U8LUT(0T8UDLUT$TST (T  HTHbbLbTb @U@H`HPUP``U `c cha`aaa abRb b(f(0R0xfR f8 (T ,U ,V\dadpRpaRaP``0 (T@T (UT\a\dRdhatRaHl`t`8UR8XR`pR8 (TDT ,U ,VPt`|`\dadlRlpa|Ra8 <T<`` <U<bb 0VP\VTaa`hchtRtcRc <T U T U V W( 8T8a4` $T U $V( <T<`T8a<TT(0\alta TTT``$L`T` PUP$bb$DbTbbbcc$@cTccc dhdddR<DRRaa$HaTaa$VVV\`V`dT|V Zp0 HTHPVXpVTVVTVVV0LV`pV8h`p``p`X`bbhbR0XY`hR8HaXdaapaH (T(@`0<Rd0 TTT`T`T`Td`<Lapaaadapccc(dcpbb0dbLaa( <T<`T8a<TT$ dTd`T$`Lxbb$bcc$cg$ggddd`aV<LV\pV|VVhVZ8 8T8D`DLTL`` XUU$8S8`0 4T4pa DUD` ,V,<Wpa,8Vp( dT dU PV T U V8 0T0aaa 0U0``` @VTVVV HWW8bVbbb T U V T U V T U V T U ( 0T0p```DhRRRp```W`( 4T4``$`,`` <U<xbbb,`bHlRRRRR,XR$0 (T(`$` pUU$U |VV$V |WW$WX TTTnn0`nXn TUTb b04b4xbXb TVTff0hfXf TWTcxc0<cPtcXc4dxdd<pdd4XdcRcRc<HRHPca$a<Pag g<Pggee<leXex`(`X`PX`RS S$0R HTHD`L``L@aLaad4dLdd8XxXX gg (gLggg$nLnnS( 0T0a <U<|b <V<T`X`0 0T08`8LTL``` XUUU8D```S0 0T0aaa ,UUTRR8 @T@H`HlTl`D`p`dRH&&__get_threadg__get_stack_basepthread_attr_initpthread_attr_setdetachstatepthread_attr_getdetachstateYpthread_attr_setschedpolicypthread_attr_getschedpolicypthread_attr_setschedparam pthread_attr_getschedparamR pthread_attr_setstacksize pthread_attr_getstacksize pthread_attr_setstackaddr pthread_attr_getstackaddr> pthread_attr_setstack pthread_attr_getstack pthread_attr_setguardsize pthread_attr_getguardsize> pthread_getattr_np pthread_attr_setscope pthread_attr_getscope __pthread_cleanup_push@ __pthread_cleanup_pop pthread_self pthread_equal pthread_mutexattr_init pthread_mutexattr_destroy2 pthread_mutexattr_gettype pthread_mutexattr_settype pthread_mutexattr_setpsharedpthread_mutexattr_getpsharedApthread_condattr_initrpthread_condattr_getpsharedpthread_condattr_setpsharedpthread_condattr_destroypthread_cond_init[pthread_cond_destroypthread_getspecificpthread_getcpuclockid-__pthread_gettidepthread_setname_np@pthread_sigmaskpthread_kill+pthread_mutex_initvpthread_setschedparampthread_getschedparamjpthread_attr_destroy__init_tls__futex_wait_ex__futex_wake_ex pthread_cond_broadcastpthread_mutex_lock_timeout_npUpthread_mutex_trylockpthread_mutex_destroy7pthread_mutex_unlockpthread_cond_signalNpthread_mutex_lockIpthread_once__pthread_cond_timedwait_relative1pthread_cond_timeout_nppthread_cond_timedwait_relative_np__pthread_cond_timedwaitwpthread_cond_timedwait_monotonic_nppthread_cond_timedwait_monotonicpthread_cond_timedwait^pthread_cond_waitpthread_detach pthread_join_init_thread.pthread_create pthread_exit{"__thread_entry"pthread_setspecific#pthread_key_create$pthread_key_deletet @(< (4(8 Xh  0<L0(( L $( p(< $pHd$p `$X` 048\ T`l T`l<DL l4X ,D<xx|D\0|D$04048\ |$t  (8 0,48@48@`pt`dp`dp<P44ThxltThxlt(DLxLx ,0T ,0TTTTdllplp4HL\ @(< (4(8 Xh  0<L0(( L $( p(< $pHd$p `$Xoldvalpthread_tGNU C 4.4.3pthread_attr_getschedparampthread_getattr_nponce_controlonce_lockPTHREAD_MUTEX_ERRORCHECK_NPflagspthread_mutexattr_tpthread_mutexattr_destroyunsigned intnext_pthread_internal_addpthread_mutex_trylock__pthread_cond_timedwait__int32_t__get_stack_basepthread_condattr_destroypthread_attr_getdetachstateoldv_tlsmapprefpthread_cond_waittlsmap_setpthread_cond_broadcastpthread_mutexattr_getpsharedfunc__page_shiftstack_addr__pthread_cleanup_func_tssize_tpthread_getschedparampthread_detachpthread_attr_setschedpolicypthread_mutex_unlockpthread_cond_signalpthread_mutex_locktlsmap_t__kernel_pid_tpthread_internal_tpthread_cond_tpthread_oncetls_dtor_tuint32_tpthread_mutex_destroypthread_attr_initpthread_cond_initfloatmutexpthread_key_tjoin_conddtorpthread_mutexattr_gettyperesultpthread_attr_destroylong long unsigned intpthread_create__pthread_cleanup_tstart_mutex__pthread_gettid__timespec_to_relative_msecPTHREAD_MUTEX_RECURSIVEpthread_condattr_init__isthreadedgDefaultPthreadAttrpthread_attr_getscope__recursive_lockstart_routinepthread_sigmaskpthread_attr_t_pthread_internal_freeinternpthread_attr_getschedpolicytlsmap_clearvalue__pthread_cond_timedwait_relativepthread_condattr_setpsharedtlsmap_unlock__cleanup_argcountertv_nsecsize_tcondmtypetlsmap_testpthread_mutex_lock_timeout_nproutinereltimescope__kernel_time_t__futex_wake_exkernel_idpthread_cond_timeout_npclockreturn_value_normal_lockcountpthread_cond_timedwait_monotonic_nptimespeccharpthread_attr_getstackaddrpthread_attr_getstacksize_normal_unlockexitdatapthread_mutex_initPTHREAD_MUTEX_ERRORCHECK/u/raghu/ics_feb29uint8_tstatussched_prioritytime_tmadestackexecuteretvalpthread_cond_timedwait_monotonicbionic/libc/bionic/pthread.clong long intpthread_killpid_tstack_baseatypegThreadList__cleanup_routinepthread_selfpthread_key_deleteold_errnoocptrpthread_setname_npinit_routinepthread_cond_timedwait__pthread_cond_pulse__timespec_to_absolutestackSizesizepthread_attr_setscopeparammmap_lockpthread_attr_setstacksizejoin_counterr1roundsdonecleanup_stackguard_sizenew_lock_typeabstime__pthread_cleanup_pushthidtlsmap_lockpthread_condattr_ttimeoutdtors__thread_entryuser_stackPTHREAD_MUTEX_NORMAL_pthread_internal_alloc_recursive_unlocksigset_ttlsmap_alloc_recursive_lockshort intpthread_joinpthread_attr_getstacklong int_pthread_internal_removeattr__init_tlsthnamepthread_key_clean_alldestructor_functionpthread_getcpuclockidsaved_errnopsharedpthread_condattr_getpsharedpthread_key_createthname_len__futex_wait_exthread_out__uint8_tstacknewvalcomm_namepthread_equalpthread_attr_setstackaddrinittv_secshared__get_threadlong unsigned intp_stack_sizepthread_attr_setguardsizepthread_exitpthread_setspecificint32_tpthread_cond_timedwait_relative_npthreadpthread_mutex_tpthread_getspecificclockid_tCLOCK_IDTYPE_BITSgThreadListLockret_val__cleanup_prevsched_paramtypeunsigned char__uint32_tpthread_attr_getguardsize_pthread_internal_remove_lockedPTHREAD_MUTEX_RECURSIVE_NP__page_sizestatepthread_mutexattr_settypepthread_cond_destroy_init_threadgStackBasesigned charshort unsigned intthrInfo__valclockid_tlsmap_lockpolicydoublesched_policystack_sizeoldvaluepthread_attr_setschedparamExitoset__kernel_clockid_tpthread_mutexattr_setpsharedpthread_attr_setstackretValuemsecspthread_mutexattr_initFoundItpthread_setschedparamPTHREAD_MUTEX_DEFAULTpthread_attr_setdetachstatemkstackgDebuggerNotificationLock__pthread_cleanup_popGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.__get_thread.rel.text.__get_stack_base.text.pthread_attr_init.text.pthread_attr_setdetachstate.text.pthread_attr_getdetachstate.text.pthread_attr_setschedpolicy.text.pthread_attr_getschedpolicy.text.pthread_attr_setschedparam.text.pthread_attr_getschedparam.text.pthread_attr_setstacksize.text.pthread_attr_getstacksize.text.pthread_attr_setstackaddr.text.pthread_attr_getstackaddr.text.pthread_attr_setstack.text.pthread_attr_getstack.text.pthread_attr_setguardsize.text.pthread_attr_getguardsize.text.pthread_getattr_np.text.pthread_attr_setscope.text.pthread_attr_getscope.rel.text.__pthread_cleanup_push.rel.text.__pthread_cleanup_pop.rel.text.pthread_self.text.pthread_equal.text.pthread_mutexattr_init.text.pthread_mutexattr_destroy.text.pthread_mutexattr_gettype.text.pthread_mutexattr_settype.text.pthread_mutexattr_setpshared.text.pthread_mutexattr_getpshared.text.pthread_condattr_init.text.pthread_condattr_getpshared.text.pthread_condattr_setpshared.text.pthread_condattr_destroy.text.pthread_cond_init.text.pthread_cond_destroy.text.pthread_getspecific.text.pthread_getcpuclockid.text.__pthread_gettid.rodata.str1.4.rel.text.pthread_setname_np.rel.text.pthread_sigmask.rel.text.pthread_kill.text.pthread_mutex_init.rel.text.pthread_setschedparam.rel.text.pthread_getschedparam.text.pthread_attr_destroy.rel.text.__init_tls.rel.text.__futex_wait_ex.rel.text._normal_lock.rel.text.__futex_wake_ex.rel.text.pthread_cond_broadcast.rel.text._recursive_unlock.rel.text.pthread_mutex_lock_timeout_np.rel.text.pthread_mutex_trylock.rel.text.pthread_mutex_destroy.rel.text.pthread_mutex_unlock.rel.text.pthread_cond_signal.rel.text.pthread_mutex_lock.rel.text.pthread_once.rel.text.__pthread_cond_timedwait_relative.rel.text.pthread_cond_timeout_np.rel.text.pthread_cond_timedwait_relative_np.rel.text.__pthread_cond_timedwait.rel.text.pthread_cond_timedwait_monotonic_np.rel.text.pthread_cond_timedwait_monotonic.rel.text.pthread_cond_timedwait.rel.text.pthread_cond_wait.rel.text.pthread_detach.rel.text.pthread_join.rel.text._init_thread.rel.text.pthread_create.rel.text.pthread_exit.rel.text.__thread_entry.rel.text.pthread_setspecific.rel.text.pthread_key_create.rel.text.pthread_key_delete.data.once_lock.4665.bss._tlsmap_lock.bss.gThreadListLock.bss.gThreadList.bss.__recursive_lock.rodata.gDefaultPthreadAttr.bss.gDebuggerNotificationLock.bss.mmap_lock.bss._tlsmap.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 `> Lp ^pH&Z |H np4j ` zC C@ $C( D<HD\D &hDHxDiDD(DDD D4&$EB 0 o  v     !"$&()*+,-./0123456789;=?@BDEGIIKMO+O=QSUWY[]N_acegikmo]mqsuyw y{}8  @(< < Xt(4(>(Xr8  !X"h$& () **0+D<,^L-{0./(0(1 2L3 4&$5:(6P7a 9t{;=p?@B)8K(D`<Eku G$KMQ&pS<HURdWgY{$[]_paceg5iVkmm o`q$sXu w$>yM{a}tbionic/libc/bionic/pthread.c_normal_lock_recursive_unlock__recursive_lockonce_lock.4665gThreadListLockgThreadListgDebuggerNotificationLockgDefaultPthreadAttrmmap_lock_tlsmap_lock_tlsmap$LC0__get_thread__get_stack_base_gp_disppthread_attr_initpthread_attr_setdetachstatepthread_attr_getdetachstatepthread_attr_setschedpolicypthread_attr_getschedpolicypthread_attr_setschedparampthread_attr_getschedparampthread_attr_setstacksizepthread_attr_getstacksizepthread_attr_setstackaddrpthread_attr_getstackaddrpthread_attr_setstackpthread_attr_getstackpthread_attr_setguardsizepthread_attr_getguardsizepthread_getattr_nppthread_attr_setscopepthread_attr_getscope__pthread_cleanup_push__pthread_cleanup_poppthread_selfpthread_equalpthread_mutexattr_initpthread_mutexattr_destroypthread_mutexattr_gettypepthread_mutexattr_settypepthread_mutexattr_setpsharedpthread_mutexattr_getpsharedpthread_condattr_initpthread_condattr_getpsharedpthread_condattr_setpsharedpthread_condattr_destroypthread_cond_initpthread_cond_destroypthread_getspecificpthread_getcpuclockid__pthread_gettidpthread_setname_npstrlen__errnosnprintfopenwritecloseprctlpthread_sigmask__rt_sigprocmaskpthread_killtkillpthread_mutex_initpthread_setschedparamsched_setschedulerpthread_getschedparamsched_getparamsched_getschedulerpthread_attr_destroy__init_tls__set_tls__futex_wait_ex__futex_syscall4__atomic_cmpxchg__atomic_swap__futex_wake_ex__futex_syscall3pthread_cond_broadcast__atomic_decpthread_mutex_lock_timeout_npclock_gettimepthread_mutex_trylockpthread_mutex_destroypthread_mutex_unlockpthread_cond_signalpthread_mutex_lockpthread_once__pthread_cond_timedwait_relativepthread_cond_timeout_nppthread_cond_timedwait_relative_np__pthread_cond_timedwaitpthread_cond_timedwait_monotonic_nppthread_cond_timedwait_monotonicpthread_cond_timedwaitpthread_cond_waitpthread_detachpthread_joinfree_init_threadpthread_create__isthreadedcalloc__pthread_clone_thread_created_hookmunmapmmapmprotectpthread_exit_exit_thread_exit_with_stack_teardown__thread_entrypthread_setspecificpthread_key_createpthread_key_deletev w@y`z{|}~ @` @` @` @` @`: @`> @` @`  @ `  ppp!o%1p>pEpJpWp^pepjpuppppppppppppppp pp p+p7pEp{ppppppppp pp p/pBpPp^plpzpppppppppppp-p9pEpSpapop}ppppppp p)pYpepppppppp pp+pHpTpgpppzpppppp pp%pKp\pupppppppppppppp(p3 7 N R Wpalipt x |lplplp  pp  pplp" & 2p@p[pfjvpppppppp p p $ 0 p> pT p_ c o p} p p   p p p   p p p   p+ l0 p@ pK O [ pi pw p p   p p p p   p p p  " p0 p@ pK O [ pi pw p p   p p l p   p p   l l p l- l2 pB pJ N R ld li pt ly p p   p   p ! ! p p " "$ p4 p? #C #O p] pk #o #t p l p $ $ p p l p % % p plp&&#p.l3pCpN'R'^ptp((ppp))ppp**pp+ +,p:pEl]ph,l,xpp--l--plp..lp pp/p;/?/KpYpgps1w1{lplplppllp1oppl11)lBpN2R2Vljlzlpllplp33lll lplp-p84<4HpVpalfpqlxp55lplplplppllp66lplp)l.p9l>pIlNpellpw7{7pp88lplp99lp ll p*l7pEpQpb:f:jlwllp<<lpllpppppp"p-=1=5l>pIlR=V=h=l=ulzolp>>l>oolpAAlplpl pp7pBlRlWpcpnlsp~lAoAooplAoA o#o(p3l8pHALoWpbBfBjlsp~lpllplplopBoBBpC Clp"l2l9pDDHDLlUp`lepplplplDDDDlDDpEElplEE&E*E3l8oAlPp[F_Fcllpwl|pllplplFFFFloplF oFFp'l,p<F@oKpWG[G_lhpslxplpaplpIIlplplp lpl!p,l3p>JBJFlOpZl_pjlopzlpKKplplplpLLlpl plp$l)p4lRl[L_oypMMplplplpNNplplp lpO"O.p9l>pIlNpYl`pkPoP{plplpQQlplplplplppQpTT"l+p6l;pFlKpVl[pflkprT{ToTopUUlplplplplUoUUp0p;V?VClLpWl\pgllpwllpllplpplppl V o o# o, p7 l@ VD VW V[ oq oz l V V V p p Z Z l p l!p!l!p"!p.!p:!Z>!ZV!ZZ!of!o!Z!Z!o!l!l!o!l!l!Z!o!o!Z!o"Z"Z"l"Z "o("o:"Z>"ZS"ZW"oi"Zm"o}"p"]"]"l"p"l"l"l"p"p"p"p"^"^"l #l#l-#lB#^F#oR#ob#^f#^x#^|#^#p#l#p#_#_#l#l#p#l#l$_$o$o"$_&$o<$oJ$_N$on$_r$o$_$o$p$`$`$l$l$l$p%` %`%o%o*%`.%oI%`M%`c%`g%o{%p%p%h%p%f%p%d%p%c%p%g%p%e%p &b&p&i &p-&p:&p  - @ V j|"7Rdx ! " #6$V%t&'()*+,-1.G/X123485X6789:<=(>UABCDT E| F G* IF Jc Kt L M N O P QL T U V Z ] ^ _[`xx vxx vxx vxx vxxD qq  $ < L `   xx < d xx 8 t xx < | xx( D h | xx0 xx xx( l xx xx< ` xx$ (e,eD He eLexx<  $ X   T vt >>x ee ::   :: ee >>xx@ v :: ee >> :: e eH >L>xx xx@ vH ` :: ee >>( >8>T xx< ` xxP vX  >>  ee( :,:\  :: ee >>xxP Tap L axa xx, L l xxP xx xx0 xx xx xx xx xx( 4c< d@dH \ dc c $ ccxx( 0c@ dDdL ` hc c c$ c cH xxh c ddd p cc xx< \ `  4 <gD T 0 g\gd      0 f8f h   h $  h,h@ xx< v b iii ii  bbX  b`bli T bb c c  P  cXcl | L cc   iiii i ixx$ @ T t xxP Tbd ihiti L bbiixx$ 4b< i@iLih b bbiixxp xb iii l bb c ddH c`cxij $j( <j@ LjP \j` ljp|jjjjjjjjj jj ,j0<j@LjP\j`tjxjj j!j"j#j$j%j&j' j$(0j4)@jD*PjT+`jd,pjt-j.j/j1j2j3 j4j 5<j@6`jd7pjt8j9j:j<j=j>jA4j8BTjXCpjtDjEjFjGjI$j(J<j@KLjPLljpM|jNjOjPjQjTjU jV@jDZtjx]j^j_j` ( @ P ` p 0@P`x !"#$%&'$(4)D*T+d,t-./1234 5@6d7t89:<=>A8BXCtDEFGI(J@KPLpMNOPQTUVDZx]^_`    ( , 3 7 F J Y ] lp#'7;BFMQ`dko~####$$$$%%%%&&&&++++---#-2-6-E.I.P.T.c1g1o1s111111111111111111111111 111#1'1.121A1E1L1P1W1[1b1f1m1q1111111111111111111222222&2*292=2L2P2W2[2b2f2m2q2x2|222223333333333333 33333&3*393=3D3H3W4[4j4n4u4y444555555555555555555 5$5+5/565:5A5E5T6X6`6d6t6x666666666666666666666 6666#6'6.626A8E8T8X8g9k9z9~99999::::::::::<<<<*<.<==A=I=M=]=a=h=l=s=w=====>>>>>>>>AAAA A A A A! A% A, A0 A7 A; AJ AN AU AY A` Ad Ak Ao Av Az A A A A A A A A A A A A A A A A A A A A A A A A A A! A( A, A3 A7 AF AJ AQ AU A\ A` Ag Ak Ar Av A A A A A A A A A A A A A A A B B B B B B B B B B# B' B. B2 B9 B= BD BH BO BS BZ B^ Be Bi Bp Bt B{ B B B B B B B B B B B B B B B B B B B B B B B B B# B* B. B5 B9 BH CL CT CX Ch Cl Cs Cw C C C D D D D D D D D D D D D D D D D D D D D D D$ D( D/ D3 D: D> DE DI DX D\ Dc Dg Dn Dr Dy D} D D D D D D D D D D D E E E E E E EE E EE E/E3EBFFFNFRFcFgFnFrFyF}FFFFFFFFFFFFFFFFFFFFFFFF!F(F,F;F?FNFRFYF]FdFhFoFsFzF~FFFFFFFGGGGGGGGGGGGGGGG G$G3G7G>GBGRIVI^IbIrIvI}IIIIIIIIIIIIIIJJJJJJ%J)J8J<JKKOK^KbKqKuKLLLLLLLLLLLLLLLLLLLL LLLL"L&L-L1L@LDLKLOL^LbLiLmLtLxLLLLLMMMMMMNNNNNNOO"O&O5O9OHPLP[P_PnQrQzQ~QQQQQQQQQQQQQQQQQQQQQQQ'T+T3T7TGTKTRTVT]TaThTlTsTwTTTTTTTTTTTTTTTTTTTTTTTUU#U'U7U;UBUFUMUQU`UdUkUoUvUzUUUUUUUUUUUUUVVVVVVV VVVV!V(V,V;V?VFVJVQVUV\V`VgVkVrVvVVVVVVVVVVVVVVVVVVVVVVVVVVV$V(V/V3V:V>VEVIVXV\VcVgVnVrVyV}VVVVVVVVVVVVVVVVVVVVV VVVV V$V+V/V>VBVIVMVTVXV_VcVrVvV}VVVVVVZZZZZZZZZZZZZZZ ZZZ$Z(Z/Z3Z:Z>ZEZIZXZ\ZcZgZnZrZZZZZZZZZZZZZZZZZZZZZ] ]]]']+]2]6]E]I]P]T]c]g]n]r]y]}]^^^^^^^^^^^^^^^^^^^^ ^^^#^*^.^5^9^H^L^[___g_k_{________________```` ````!`%`,`0`7`;`B`F`U`Y`   ( 0 8@HPX`hpx !"#$%&'()* +(,0-8.@/H1P2X3`4h5p6x789:<=>ABCDEFGIJKLMNO P(Q0T8U@VHZP]X^`_h`111 1== =$=0>4>8><>H>L>P>T>`AdAhAlAxA|AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA A$A(A,A0A4A8A<A@ADAPATAXA\AhAlApAtABBBBBBBBEEEEFFFFFFFFFFFFFFFFFF(L,L0L4L8L<LHTLTPTTT`TdThTlTxU|UUUUUVVVVVVVVVVVVVVVVVVVVV VZZ Z$Z0Z4Z8Z<ZHZLZPZTZXZ\Z`ZdZpZtZxZ|ZZZZZZZZZZZZZZZZZZZZZZZZZZZZ ZZZ Z$Z(Z,Z0Z4Z@ZDZHZLZXZ\Z`ZdZp^t^x^|^^^^^_____________________ _____ _$_0_4_8_<_@_D_P_T_X_\_h_l_p_t_x_|___````````````````           $(,048<@DHLPTX\`dhlptx|  !!""##$$%%&&''(())**++, ,--.. /$/(1,1024283<3@4D4H5L5P6T6X7\7`8d8h9l9p:t:x<|<==>>AABBCCDDEEFFGGIIJJKKLLMMNNOOPPQ QTTUU V$V(Z,Z0]4]8^<^@_D_H`L`dlmalloc.o/ 1331264896 1002 1002 100644 152232 ` ELFXAP4(WTH(@(@0(`@(X0 (?@(H(% RU$ > : ; I$ >  $ >  I : ;  : ; I8 : ; I8 ' I I &II!I/  : ; : ; 5I : ;I8  : ;I8 : ;I : ; : ; ( .: ;' I : ;I4: ;I: ;I 4: ;I.: ;'  4I4 ! ".? : ;' I@ #.? : ;' I@ $: ;I% &.? : ;' @': ;I(4: ;I) U*4: ;I+' ,&-.: ;' I@..? : ;' I@/1RUX Y011412413.: ;' @44: ;I 5.1@617 U81RUX Y91X Y:41 ; : ;<4I4  = >1X Y?4: ;I @!A4: ; I? < 3+=)int ;m!>14< l8CNW X# zY)#IQTw  _px# _ry)# _wz)# {P# |P# _bf}# ~)# # J# )<#$  \#( #, #0 _up#8 _ur)#< " #@ #C _lb#D ")#L #P )   )< )" \ )B )| | ) bIIQ(nR 10# #20# 30# 40# k50# 60# 170# 80# 90# e:0#$)i *i#)N+R0#0#fd#bk# yzr;;;& {x}0#~0#fdx#bkx# ~#x##xxxh#J0###  j) *#+#>,0#-0# .#dv/#top0#10# 20# / 3#$4"#50#L90#:#<n#seg>#"A2 A>K L0#M0#VN0#O0# EP0#ZQ# !w=^ )"^ )^ )val_ 0a m 2nm  0 0sum 0s q sz 0O m 2 0fp 0 0s q m2sp)Pm2ssspH) m) 2p) ) 0+ 00 m2+0sp T J0p0tp! XPR!J F!h RP CP H$ C0C1H$ I! X0Y;N;K;TK0! C F    m 2nb 0 0mm  0 0p  8  m8 2i: bin< n  m 2  0     0e  0asp csp sp ss  p e ) T n!  q  0tn ! I B F TP H $ I !K X 0Y ;N ;K ;T K 0!p C  F   D mD2nbD0tEvEF0iGH T !% YI;KI;NI;!7 GO0rW! XPZRZ!l FZ! RPZ CPZ HZ$ C0ZC1ZDVS`0DV`I`B`F`  m20i0!Ea0nb0req0mem7p!brpos0!0J00 8m 2 nb 0  0)l+ml2Olil0 T;)r s0tuv!nb|0!0!0}0Coc0; ++ m 2Z 0 ! )<:000memp0 J!0i"0YZ00bU &mU 2U )U nbV 0pW X Y 0qZ [ 0 T&b!d 0!j 0!|pp 0!Fq Bq Iq TPq XPq Rq !7Fq !URPq  CPq  Hq $ C0q C1q !Iv Bv Fv TPv Hv $ Iv !Xv 0Yv ;Nv ;Kv ;Tv Kv 0!Cv  Fv   m 2nb 0  02 !mem !br ss  0! 0end! req,0-0mp/!B90br;end<B0!SmnZ!rspa)t0pr))m2pad0+000sp!!0^vpm2nb0v0tidx Tp!X0Y;N;K;! 0rstrtG0!;iY;K;N;!MG%0r0!XP3R3!F3!RP3 CP3 H3$ C03C13!I9B9F9TP9H9$ I9!:X90Y9;N9;K9;T9K90!_C9 F9 "0"n0#0T$mem%Lp&[='=?'@s(sBmC2)(pH)K*K0*/L0Y*L0+  0  0 ,- )%Ts 0&'' 6m 2)P(su)x(p)/00)*5+ .@)S+')s')/0 0)1.L/"8@04)h1>)1J1V1b2n)2y%)2o&$/(0)222)2)(2;3oa$msg|'{|49a}q5 62X07@2&12p7h1)1 18P6r6h0^)2~Y9|E00%|19w090/%2D%1/0)212n :)82 2 1)x12 )1 71 2 g 70Q2 2 7XA2 c )x2 )2 9%2 b2 2 N)2% 20 f72O )1[ 72? G)01i )X2t 2 &(  !$mem;}l@62Z81f2p :0;:|=dX&21;%11 %2;2$(<2.<=H l k&1@7&2@=1)117&2=%02=2`>2?)02N?7&112@7f'2]@A2hA78'1)2B2&C7K'2wpC)02C)P1)h1)12}D7'2D%42'E2$E2.F)2;F2EbG7'2TG) 2`H/+80G)2RaH2^ J2jJ0=7hQ(1s2OK18PxW(6rK6hK0^)2~-L7,2X@L7P*2dM/'w0[0O0C)X2fM2pN1|2LO2O09:7)17): 7H)1)2P2HQ7p)2<R)1H7)2,JR)(1V)X2aR2lR)p2(S2S17)112S7x*1)12HT7<*2T%,2T2 H\U0 %H\1 %HT1 . ..@^%/'0^'i0|_/(0)007/2F_1Q2]_)2je`2v`2`7(.12`112a%2=a%2a2a%p1:.`ad/'i0a*0 b. Hb/'i0?b0.Rb0'Osb'i0b)@m2/8@0`0T0J):l)1{2_c2c2c2td7002d=H02d%H2 uZJKOzJFKLfJGMHLJKLw J!"8Jtf(0Nx,R,IKFIsJ $LHKI|JJ|JIQHLGKLKEOt   JJ J JJ <$=KwKIKa&JAK +`    vtt   v XXH#\H ` PH"< vtJ JLKMJ#%*+J,-/1034  LJ#%*+J,-/1034ID<$q0u<<   J t|z$ x J JJJJJJJtvJ <\J <tKKIK= 7 vt.  R<.$MGLHKL@KILLKc>K)R$ \! $!$\&$$&))\K\4L$$$("$\($$"\.(R$22$  #uIKot=IKzP!<<w5 JKKKFLKLI J4LKIKLIMlt$,LLKIIIL{JIK|XIKLPKHLHL$J|Lvu JEKNKzJQyJQyJKFO}~C"JuL> ?IKLHLH<f<-JuOJuL}<=I I~vJL> tKyJJKJIQHLGKLKJJJKJ=KKKOKKII$JMIIHLKKM|L?MJ J!"_J|B~ MG= <twRyJIOHLMEIMMKuMJ>;zJPv| J KOEzJ = J!"{t+IGGK}KPHLGKLKEOI}JJHL}JKJ JyJIQ <KIMII$J~ J t,\<}$K,J|<$tJJJJJJ t J{JIHLJyJpIQHLGKLKEO|tKHKK$J |<d<  t }L_ J t}, vHL4<z,|=Klt$}  t <$tJJJJJJ t zg=L| <|d   JtJJJJJJ< _<|<$~t#%'*+J,-/1034 |< }( }t\KILJ}JxKILHJ}J .$ty}$& !X| $  ("|( (u<,(|4y=)C$2(4y_(z$  #|(QL==o%JKLIKIRJ|J|J|JJ|<IAKIKfmJ|<jtIuIe<9( #L?HKIKI#v>I#0{ txJRyKP {{JJ|JJ{$t=J{({J{0KLKHKKIqAIKKILIgJJz<JJm|=K"yKtxt <J4J(} J}JJJIKI JKIIKKLKwJrPKwJKzJKJ~QyJRyJ $K[((d+ t ~+`w '`,%!lJT+ߎӮ`+ c@v+C Sb@ +HJ Sb46!QT#rѮN$ N@ $@K&<840,($ @'$$^!xQN _,$ D$$$_!""+0G2 RB Q'@! <+`MN$<b&$C@$x"@%RBR R p1<840,($ % @'C$$x,b%@@$xBB$#q$!?W$($!(E@+@DC+0d} rR@ BC%㮣!  ߎ# !H$j%!IK+pIS ׮W _ ^BX$%!I+H`ׯ $m!`3%# S !( @#p2hB%h2 ,'L  $#1#0j y#8#+!'Q2@!p,%$![(v +`%y% %+ `BRR R+pd&' ' !*)6 tI+9@9& ! 4!p/!hN5+L$E0+ $$C!Q56ѮU<! $Hj'8 $0sSP`W&b@w&!@b@b@+Pw&!@$@t'0$2`&b@c&!@b@b@c&!@r@+fSc`(`S$e'$6k`S$po'$y`ӮӯG`&b`&bD$9% E%$y$ $ y$$ $D$' $$Y$ e$$%$ % $%$ %!d$Y$ $ %& e%D%% %%J! $%$ %%y% %%$ $D&<'!'$ b@!&0y% !  I1 !@$! ('$ @ $@%y% !  I1 !@ %$! ('$!! ('<'!'TPLHD@<840&bY@!P&0Z'.+ (.5.o 1&$+Q\#Q + "#`Q !(Q5+6 V%K0T $T!PLHD@<840X'L 1&$$$Kj0+@n09!$%!tvю ,qB+%@ 3q6ʮ!&15y$ @ $@P&+Q%#Qs,`!!C46x4XԮ&$`$# $$)(! I4!ɮ(5'&`$#p%h$Xm#` $&S E1B1084@1GB 0x!%B!3!p!h!m$%!ӎ k$+h@ t#!J616!XrѮrj@¨d$(h$`!@%xo! Q" 7B&@#<+EI$ $J+%P ! B@ $#,Bh $#(Y$!$&#+p(!8!'D!xX!`!`!8@!`Y!$&#+p@('D!xX!@!% U0 n+. U0o%!#0$+5@U0o%+p!F+@ & ! $J!@lb)%E$!Xq# $$d#0!p$h#w!<7+o}@$$5 LpN^pf 3Z YU npq9j @wU ~4Rz w U LR x UdRTR 0x0UT `xU U xU.4X* yPUBXL> yUS2@[f[$b xzU^{ p{pU^  {8U!h  ~xU#s$ U%t,  8U'@ U) 4` Ќ8U+H 8U-0ܘ, @U/D@ P(U1WlS xU3p@l  U54  ( U7TTTl $ >Xrġ ССpС  H`UEܤ  UGp8k XUIp d UKp UMpLh 2UO$p039 /0<8o<=HN VO V   D$1C99J!^ !o;:#=%' >@ B?A)+-/<133579:;<=>?@ABCDEGIKMOQ"'8,T1d6l;t@RSE XaxT L$&+3;C\ch #o$%}, '@)`+H-/1@5 7bionic/libc/bionic/dlmalloc.c_gm_init_mparamsmparamsmagic_init_mutex__bionic_heap_errorsys_trim.clone.3__FUNCTION__.4249morecore_mutex__FUNCTION__.5601__FUNCTION__.5410__FUNCTION__.4563__FUNCTION__.3891__FUNCTION__.4874__FUNCTION__.3575__FUNCTION__.5045ialloc.clone.0$LC0$LC1$LC2$LC3$LC4$LC5$LC6$LC7dlmalloc_footprint_gp_dispdlmalloc_max_footprintdlmalloc_usable_sizedlmalloc_walk_heappthread_mutex_lockpthread_mutex_unlocksysconfabortpthread_mutex_initdlmalloc_walk_free_pagesdlmalloptdlmallinfodlmalloc_stats__sFfprintfstrlcpystrlcat__libc_android_log_writemunmapsbrkdlfreedlmalloc_trimdlmallocmmap__errnodlmemaligndlpvallocdlvallocdlreallocmemcpydlcallocmemsetdlindependent_callocdlindependent_comallocO Q@R`SYZ[\ @`defijk l@n`,pq BBB!A%1B>BEBLBSBZBaBhBoBvB}BBBBBBBBBBB,BHBVBdBrBBBBBBBBBBBBBBB BB(B6BDB[BoBzBBBBBBBBBB BKBZBiBBBBBBBBBBBB,B;BJBYBBBBBBBBB3BEBRBaBpBBBBBBBBBBBBBBB B#BKBWBBBBBBBQBsBBBBBBBBBB B+ BR Bk Bw B B B B B B B B B! B- B9 Bs B B B B B B B B B B B+ BBB*BkBwBBBBBBBBB,B9BUBaBmBvB|BBBBBBBBBBBAB]BiBuBBBBBBBBBBB(BDBPBqB}BBBBBBB,BSB_BkBBBBBB4BeBtBBBBBBBBB*B[B}BBBBBBABwB  B  B  >  B  >B>B>-><AJ>OATB`Bk>pB{>B>B>B> B>B'>6AD>IAW>\AaBmByBBAB>B>B>B>  AA-B9=A>NRA_AiA>A>A>B>AA>>>A>A>B $(><>ABL>QBvz~>>>A>>AAA>>A> 6:JNdhq>x|AA>>2A>>A>AA>A!>*>/A<>BAK>RA[>`dm>v>>A>>A>AA>AA>>B >>#B*/B:4?BFKAY>^AcBn>sB~>BABAB>AA>>A>A,A>>CAR>a>hAv>~A>>AB>AB>A>> A A( >6 >; AN >S Ae Aw >| A > > A > A > > A A!>!A(!>6!>;!AM!>S!Aa!>h!Av!>{!!!>!>!>!B!!!>!>!B"> "B" " ">'"B2">7"BB"5G"BN" S"Ac">r">w"A">"B">"A">">">"B">">"B">#B #A#>-#>;#>A#AS#>Y#Ai#>n#A}#>#A#>#>#>#A#>#>#A#># #A $A$> $>5$6:$AG$>L$AY$>^$Ag$>l$Au$>$>$A$>$>$A$A$>$>$A$>$A$>$A$ $ % % %>!%>*%>3% 7% @%BU%>e%An%By%>%>% % % % % %A%A%>%>%>&7 & & &>& #& 2& 6& ?&>H&>Q&>Y& ]& l&Ay&>&A&A&>& & &>&>&>&A&>&A&>&A'> '>'A 'A)'>2'>9'AF'>L'AU'>Z'Ag'Aq'A'>'A'>' ' '>'>'>'A'>'>'A'>'A'>' (A(A(>"(>+(>5(AG(>V( Z(Aj(>s(>}(A(>(A(>(A(>( (A(A(>(>(>(> )8)A)A.)A<)AE)>N)>S)A`)>e)Aq)A~)>)A)A)>)>)A)>)>)A)>)A)A*>*A*>* * $*>-*>6*>=*AF*>O*>T*Aa*>g*Ap*>y* }* * * *>*>* * *>* *A*A*>+>+>+>%+>.+>>+9[+ _+ u+ y+ + +A+>+>+A+>+ + +A+>+>+A+A ,>,A,>", &, /,>8,>A,>H,AQ,>Z,>_,Al,>r,A{,>,A,>,A,>, , , , ,A,A->-A-A'- +-A=-AF->K-AT->Y-Ab->k->t->~-A-A-A- - - - - - - - - - .B).&-.&1.>:.BE.>J.BU.>^.&b.Ay.A.>.>.A.>.>.>.A.>.>.&.&.>.&.&/> />/&/&'/B3/'7/';/>D/BO/>T/B_/>f/Br/(v/(z/>/B/>/B/B/)/)/>/B/>/B/>/A/)/A 0A030A*0>30><0>E0>J0AW0>\0)`0)m0>r0)v0)0>0)0A0A0)0)0>0>0A0>0A0B1+1+ 1>1B1>$1B/1>?1>I1,M1,Q1>^1>g1>p1>y1>1>1>1>1>1>1>1>1,1,1B1.1.1>2B2>2B2>$2B/2>D2BP2/T2/`2Bk2>p2B{2>2B2>2B212B202B2:2B2;2B2B2B        Z&?'Z(p)x+,./PP ;;PP ;;PP8 ;H;< ;L;PP$ :(:T Tt0x: U4 00 V W X: ;; ;;PP8 :@:L ;P;l ; ;t;X \t Tp ;` ;|; ;;4 U ;8;PP  P :l:x :: ::PP8 :<:H ;L;p ;x;8 U4 ;\ ;@;  T ;; ;;PP( :,:8 ;<;d ;t;  ] ^ C CC0 ^, D4DL ^H EPE4  T ;L ;; ;; ] U ;;PP, _( F8FP `l `h GpG ` a HH WPPD ;H;h :l:d ;p; ;; b b0 bL b bT T`1h c UP 11 c0 c4 P ITI 2\2  II 22 II , 220 L@ IPI 2X2  II( 22 $ II 220 H ( IL I 2T 2x I I  | 2 2PPD :H:T ;X;  ;,;P ;\;P  $ T  ;h ;,;@;; ;; ;;T UP ;|; ;;4 ;<;h ;p; ;; b ;; I I I@ I$ I IL I  II | 44  II  4$4\ `;;@;8 ;T;P J JT J\ `  4h 4t I I|  X 4 4   I Ix 4 4 I I   4 4 I I   4 4` I I   4 4 I, I( 0  48 4H IP IL T $ 4\ 4 Ip Il t h 4| 4 I I   4 4 I I   4 4 I I   4 4 I I   4 4 I IPP :$:0 ;4;H L  T ;D ;; ;;  U ;;PP< :@:P ;T; U ;d ;;0;H ;T;t;  T ;;; ;;p ;x;;  g ;;T T\1d c c c( U01`:t ;x; ;( ;0;D ;L; c U 1 g hX I@ I IL I( I I I Ix I< I$ I Il I I   5$ 5 ; ; ;( ;0;; ;; ;; II  55 ;; ;;;P I\I `T 9h9$ ;@;( ;D;;;; ;; ;;\ T@ 1d1 c IIX  66@ TP 1H1P cd c 1t1x U h  7 77| II II  8 88 II  88  IHI L@ 5T5l; ;; II 66  IID  88 I<I @0 6H6 IdI4 hX 6p6 II\  88 II  88 II  77 II 77 I I  77( 707 <  IDI IdI, h\ 8p8| 55` P II II  99 II  88 II   66$ 6,6 8L I@I I`I( dX 5l5x II\ | 88 II  66 II  77 II  7 7 I I   7 7PPP hd f :: ;;$ d8 d hX f U| ; ;;  T ;; ;;PP $< i8 :@:PP 4 i0 :8:PPD :H:X ;\; f dT @\ T ;l ;h; h ;;H UX ;T;h 3p3l td J J|J U ;;  fL d m dPP< hD fh oPP f ;;  fd :h: U| ; ;; op ( T$ ;8;PP ,(,PP ,,< $<( 4<8 D<H t<x<<< <0<4T<X<<< <&4<8'P<T(h<l)<+<,<.</ ( 8 H x4X &8'T(l)+,./     " * . ? C J N U Y ` d s w ~                           ! 0 4 ; ? F J Y ] d h o s        #'6:AELPW[bfuy "&59@DSW_csw~ %)04;?FJQU\`osz~ !(,;?FJQU\`os{$(/3:>EIX\cgnry} &*15<@GKRV]apt{ %)04;?FJY]dhosz~      $ ( / 3 : > E I P T [ _ n r y }                             & * 1 5 < @ G K R V ] a h l s w ~                           ! ( , 3 7 > B I M T X g k r v }                             # * . 5 9 @ D K O V Z a e l p w {                             $ ( / 3 : > E I P T c g n r y }                        &*9=DHOSbfmqx|%)04;?NRY]dhosz~  '+26=AHLSWfjqu|")-48GKRV]ahlsw~%)04;?FJQU\`gkrv} "&-18<CGNRY]lpw{  '+:>EIPT[_fjqu| &*15<@GKRV]ahlsw~  $+/6:AELPW[jnuy%)04CGNRY]dhosz~  /3:>MQX\cgnry} &*9=DHOSZ^eix|%)04;?FJQU\`gkrv}  '+26=AHLSW^bimtx !%,07;BFMQ`dkovz #'.29=DHOSZ^eipt{  $+/6:AELPW[bfmqx|%)04;?FJQU\`gkrv}      # * . 5 9 H L S W f j q u |                    !! !!!!#!'!.!2!A!E!L!P!W![!b!f!m!q!!!!!!!!!!!!!!!!!!!!!!! " """"#"*"."5"9"@"D"K"O"^"b"i"m"t"x""""""""""""""""""""""## ####"#1#5#<#@#G#K#R#V#]#a#h#l#{#######################$$ $$ $'$+$2$6$=$A$P$T$[$_$f$j$y$ }$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ % % % % % % &% *% 1% 5% <% @% G% K% R% V% ]% a% h% l% s% w% ~% % % % % % % % % % % % % % % % % % % % % % % & & & & & & $& +& /& 6& :& A& E& L& P& W& [& b& f& m& q& x& |& & & & & & & & & & & & & & & & & & & & & & & ' ' ' ' ' ' -' 1' 8' <' C' G' N' R' Y' ]' d' h' o' s' z' ~' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ( ( ( ( ( ( $( (( 7( ;( B( F( M( Q( `( d( k( o( v( z( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ) ) ) ) ) ) !) () ,) 3) 7) >) B) I) M) T) X) _) c) r) v) }) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) * * * * * '* +* 2* 6* =* A* P* T* [* _* f* j* q* u* |* * * * * * * * * * * * * * * * * * * * + + + + + $+ ++ /+ 6+ :+ I+ M+ T+ X+ _+ c+ j+ n+ u+ y+ + + + + + + + + + + + + + + + + + + + + , , , , , , ', +, 2, 6, =, A, H, L, S, W, ^, b, i, m, t, x, , , , , , , , , , , , , , , , , , , , , , , - - - - - - !- %- ,- 0- 7- ;- B- F- M- Q- X- \- c- g- n- r- - - - - - - - - - - - - - - - - - - - - - - - - . . . . . . &. *. 1. 5. <. @. G. K. Z. ^. e. i. p. t. {. . . . . . . . . . . . . . . . . . . . . . / / / / / / %/ )/ 0/ 4/ ;/ ?/ F/ J/ Q/ U/ d/ h/ o/ s/ z/ ~/ / / / / / / / / / / / / / / / / / / / / / / / 0 0 0 0 0 '0 +0 20 60 =0 A0 H0 L0 S0 W0 ^0 b0 i0 m0 t0 x0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 !1 %1 ,1 01 71 ;1 B1 F1 M1 Q1 X1 \1 c1 g1 n1 r1 y1 }1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 $2 +2 /2 62 :2 A2 E2 L2 P2 _2 c2 j2 n2 u2 y2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 "3 &3 -3 13 83 <3 C3 G3 N3 R3 Y3 ]3 d3 h3 o3 s3 z3 ~3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 '4 +4 24 64 =4 A4 H4 L4 S4 W4 ^4 b4 i4 m4 t4 x4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 !5 %5 ,5 05 75 ;5 B5 F5 M5 Q5 X5 \5 c5 g5 n5 r5 y5 }5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 $6 +6 /6 >6 B6 I6 M6 T6 X6 _6 c6 j6 n6 u6 y6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 %7 )7 07 47 ;7 ?7 F7 J7 Q7 U7 \7 `7 g7 k7 r7 v7 }7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 8 8 8 8 8 8 "8 &8 -8 18 88 <8 C8 G8 N8 R8 Y8 ]8 d8 h8 o8 s8 z8 ~8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 9 9 9 9 9 9 '9 +9 29 69 =9 A9 H9 L9 S9 W9 ^9 b9 i9 m9 t9 x9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 : : : : !: %: ,: 0: 7: ;: B: F: M: Q: X: \: c: g: n: r: y: }: : : : : : : : : : : : : : : : : : : : : : : : ; ; ; ; ; ; "; 1; 5; <; @; G; K; R; V; ]; a; h; l; s; w; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; < < < < < (< ,< 3< 7< >< B< I< M< T< X< _< c< j< n< u< y< < < < < < < < < < < < < < < < < < < < < < < = = = = = = "= &= -= 1= @= D= K= O= V= Z= a= e= l= p= w= {= = = = = = = = = = = = = = = = = = = = = > > > > > > !> %> ,> 0> 7> ;> B> F> M> Q> `> d> k> o> v> z> > > > > > > > > > > > > > > > > > > > > > > ? ? ? ? ? ? #? '? .? 2? 9? =? D? H? O? S? Z? ^? e? i? p? t? {? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? @ @ @ @ @ @ !@ (@ ,@ 3@ 7@ >@ B@ I@ M@ T@ X@ _@ c@ j@ n@ u@ y@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ A A A A A A "A &A -A 1A @A DA KA OA VA ZA aA eA lA pA wA {A A A A A A A A A A A A A A A A A A A A A A A B B B B B B $B (B /B 3B :B >B EB IB PB TB [B _B fB jB qB uB |B B B B B B B B B B B B B B B B B B B B B B B C C C C C &C *C 1C 5C D BD ID MD TD XD _D cD jD nD }D D D D D D D D D D D D D D D D D D D D D D D E E E E E 'E +E 2E 6E =E AE HE LE SE WE ^E bE iE mE tE xE E E E E E E E E E E E E E E E E E E E E E E F F F F F "F )F -F 4F 8F ?F CF JF NF UF YF `F dF kF oF vF zF F F F F F F F F F F F F F F F F F F F F F F G G G G G G #G 'G .G 2G 9G =G DG HG OG SG bG fG mG qG G G G G G G G G G G G G G G G G G G G G G G H H H H H H "H &H -H 1H 8H S BS IS MS TS XS _S cS jS nS uS yS S S S S S S S S S S S S S S S S S S S S S T T T T T T #T *T .T 5T 9T HT LT ST WT ^T bT iT mT tT xT T T T T T T T T T T T T T T T T T T T T T U U U U U U "U )U -U V BV QV UV \V `V oV sV zV ~V V V V V V V V V V V V V V V V V V V V V W W W W !W %W ,W 0W 7W ;W BW FW MW QW `W dW kW oW ~W W W W W W W W W W W W W W W W W W X X X X X #X *X .X =X AX HX LX SX WX ^X bX iX mX |X X X X X X X X X X X X X X X X X X X X X X X X Y Y Y Y &Y *Y 1Y 5Y Z BZ IZ MZ TZ XZ gZ kZ rZ vZ }Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z [ [ [ [ [ '[ +[ 2[ 6[ =[ A[ H[ L[ S[ W[ ^[ b[ i[ m[ t[ x[ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ \ \ \ \ \ \ "\ 1\ 5\ <\ @\ O\ S\ Z\ ^\ e\ i\ p\ t\ {\ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ ] ] ] ] ] ] %] )] 0] 4] ;] ?] N] R] Y] ]] d] h] o] s] z] ~] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ^ ^ ^ ^ ^ ^ !^ %^ 4^ 8^ ?^ C^ R^ V^ ]^ a^ h^ l^ s^ w^ ~^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^&^&^&^&^&^&^&^&^&^&_& _&_&_&_& _&'_&+_&2_&6_&=_&A_&H_&L_&S_&W_&^_&b_&i_&m_&|_&_&_&_&_&_&_&_&_&_&_&_&_&_&_&_&_&_&_&_&_&_&`& `&`&`&`&`&&`&*`&1`&5`&<`&@`&G`&K`&R`&V`&e`&i`&p`&t`&{`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&`&a&a& a&a&a&#a&*a&.a&=a&Aa&Ha&La&Sa&Wa&^a&ba&ia&ma&ta&xa&a&a&a&a&a&a&a&a&a&a&a'a'a'a'a'a'a'a' b'b'b(#b(+b(/b(?b(Cb(Rb)Vb)^b)bb)sb)wb)~b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)b)c) c)c)c)c) c)$c)+c)/c)6c):c)Ac)Ec)Lc)Pc)_c)cc)jc)nc)uc)yc)c)c)c)c)c)c)c)c)c)c)c)c)c)c)c)c)c)c)c)c)c)d) d) d)d)d)d)#d)*d).d)5d)9d)@d)Dd)Kd)Od)Vd)Zd)ad)ed)td)xd)d)d)d)d)d)d)d)d)d)d)d)d)d)d)d)d)d)d)d)d)d)e)e) e)e)e)e)"e))e)-e)j,Bj,Ij,Mj,Tj,Xj,_j,cj,rj,vj,}j,j,j,j,j,j,j.j.j.j.j.j.j.j.j.j.j/k/k/k/%k/)k/   ( 08@HPX`hpx &'()+,./       $ ( , 0 4 8 < @ D PTX\`dhlx| $(,04@DHLPTX\hlpt(,04@DHLPTX\hlpt  $(,8<@DHLPTX\`dhlx|  $048<@DHLX\`dhlx| $048<@DHLX\`dhlx|  $048<@DHLPTX\`dhlptx| (,048<@DHLX\`dptx| $(,048<@DHLPTX\`dptx|         $ ( , 0 4 8 < H L P T X \ ` d p t x |                                $ ( , 0 4 @ D H L P T X \ ` d p t x |                                     $  (  ,  0  4  8  <  @  D  H  L  P  T  X  \  `  d  h  l  p  t  x  |                                          (  ,  0  4  @  D  H  L  X  \  `  d  p  t  x  |                                         $  (  ,  0  4  8  <  @  D  H  L  P  T  X  \  `  d  p  t  x  |                                   $ ( , 0 4 8 < @ D P T X \ ` d h l x |                                $ ( , 0 4 8 < @ D H L P T X \ ` d p t x |                                    $ 0 4 8 < @ D H L P T X \ ` d h l p t x |                                $ 0 4 8 < @ D P T X \ h l p t x |                                $ ( , 8 < @ D H L P T X \ ` d h l p t x |                                        $ ( , 0 4 8 < @ D H L P T X \ h l p t x |                                    $ ( , 0 4 8 < @ D P T X \ ` d h l p t x |                                        $ ( , 0 4 8 < @ D H L X \ ` d h l p t x |                                      $ ( , 0 4 8 < H L P T X \ ` d h l p t x |                                 ( , 0 4 8 < @ D H L X \ ` d p t x |                               ( , 0 4 8 < @ D P T X \ h l p t x |                                  $ ( , 0 4 8 < H L P T X \ ` d p t x |                                $ 0 4 8 < @ D H L P T ` d h l p t x |                              $ ( , 8 < @ D P T X \ ` d p t x |       &&&&&&&&&&&&&&&&&&&&& &&&&&(&,&0&4&@)D)H)L)P)T)X)\)`)d)h)l)p)t)))))))))))))))))))))))))))))))) ))))) )$)0)4)8)<)@)D)P)T)X)\)h)l)p)t)))))))))           &$&(','0(4(8)<)@+D+H,L,P.T.X/\//681 1331264895 1002 1002 100644 15928 ` ELF P4(96(H% RU$ > : ; I$ >  : ;  : ; I8  $ >  : ;  5I  I '  II!I : ; !I/' I.: ; ' I .: ; ' I@ : ; I4: ; I4: ; I 4: ; I&.? : ; ' I@ .? : ; ' @ : ; I.? : ;' @ .? : ; ' I@ .? : ; ' @! : ; " U# U$&I%4: ; I? < &4: ; I?  Ca8intD;(0y10#^20#30#z40# 50#f60#70#A80#90# -:0#$p0:r[;t-1R) )e*e# )+N {  ,O4O4A60#Y7#8#90# ;0#<0# =# C.@! @KB0#CK#\.GgGKJ#Lu#N#P# R#, 0 , 0 0 , , 0 d)=)t6=>=?)&e1AZe2Bm$tJ05K0[L0aM0N0&O0 K$, 0' /mem,,%, jg0?Q0R&, J,e0x), 00*,  0nI I 8=B4 re re#rkmsksk3sk*!q)i)!FIw"@# 0! I 0 ,$)%U;%;&#4)&6j&7&$\& r bionic/libc/bionicbionic/libc/include/opt/users/lraghu/Downloads/ndk/android-ndk-r7m/toolchains/mips-linux-android-4.4.3/prebuilt/linux-x86/bin/../lib/gcc/mips-linux-android/4.4.3/includebionic/libc/arch-mips/include/machinemalloc_debug_common.cmalloc.hstddef.h_types.hstdint.hpthread.hmalloc_debug_common.hunistd.h=NhKIGINKIKRjHL  u8LFLHLILK7J$L, <wJM JwJlJJMK>NGF =M~NGNQvtJ vJKyvJj<`+@<$iG4Be$ ($ pbp+0d+P@+XE$`+<'!bY <'!bY <'!bY <'!b Y <'!bY <'!!( D<'! <'!'$ $('<'!'D@<840,($!!%X#"D ` @ `D@<840,($ H'D@<840,($H'   <!@J5& &!0b@!NH$Hh(qbB! $@c$k%l $ $,9 0 ! b B7@e%!  $w'U&! !!!0@&!  s&&&! ؎'+(F#0!  !(!0@&!  s&&& !  |  t  4P(D,PHd  |  t $ 4 D T d t  4P(D,PHd <T,U RR\dRltR@S RR$4R$U8tUR4\RdlR$TDtT$SHtS T T T U T U T U T U T4( lTlbT b8Dbb xUUUUUU HVHXaXVaVa xWW<W HHccc<Vcceegg<Rf fV,b,HVHTbT\V\bV%mallocfree/callocjreallocmemalignvalloc malloc_debug_init!free_malloc_leak_infoOmallinfohget_malloc_leak_infogMallocLeakZygoteChildgAllocationsMutexgHashTable__libc_malloc_default_dispatch__libc_malloc_dispatchlt 4<,0 (4t 4resultMallocDebugvallocmallinfogMallocLeakZygoteChildshort intsize_tmallocintptr_tsize1size2n_elementslong long intfordblks__libc_malloc_dispatchpthread_mutex_tgAllocationsMutexvalueHashTablehead__libc_malloc_default_dispatchindexnumEntriesfreebacktracenbAlloc1alloc1alloc2keepcostarg1floatuordblksoldMemelem_sizelong intgetpagesize__uint8_thblksalignmentslotsbionic/libc/bionic/malloc_debug_common.chash_entry_compareunsigned charentryinfoSizedonesigned charlong long unsigned intunsigned intget_malloc_leak_infobacktraceSizeslotout_nomem_info__page_size/u/raghu/ics_feb29chararenalistshort unsigned intcallocsmblks__page_shiftgHashTablereallocfsmblksoverallSizehblkhdlong unsigned intbytesdoublesizecountinfototalMemorymalloc_debug_inituint8_tnbAlloc2arg2GNU C 4.4.3HashEntryprevordblksusmblksfree_malloc_leak_infoentrySizememalignnextallocationsGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.text.hash_entry_compare.rel.text.malloc.rel.text.free.rel.text.calloc.rel.text.realloc.rel.text.memalign.rel.text.valloc.text.malloc_debug_init.rel.text.free_malloc_leak_info.rel.text.mallinfo.rel.text.get_malloc_leak_info.bss.gMallocLeakZygoteChild.bss.gAllocationsMutex.rel.data.rel.ro.__libc_malloc_default_dispatch.rel.data.rel.__libc_malloc_dispatch.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X`5 H/X7>Lp^pZ /`7 np j 5X7 z t  X578  p57X  57x  57  57  5 7 57642 67I,E 67d  6(7# 67%p 67' 7X7)pv  77+pJ) <7-2psp. <`7/EpA 8=71Sp0{^0#go5Ew)8$ -   *t !"#%')+-/1345= DM%d i p x  4" 1:@GN!e#bionic/libc/bionic/malloc_debug_common.chash_entry_comparemalloc_gp_disp__libc_malloc_dispatchfreecallocreallocmemalignvalloc__page_sizemalloc_debug_initfree_malloc_leak_infodlfreemallinfodlmallinfoget_malloc_leak_infopthread_mutex_lockgAllocationsMutexgHashTablepthread_mutex_unlockdlmallocqsortmemcpymemsetgMallocLeakZygoteChild__libc_malloc_default_dispatchdlcallocdlreallocdlmemalign $@'`()*+-. 0@2 !%1>CO]ky !(49DWk"/=]ht # /9>HMWesx |      *1< @ LV[elw{#*.:DQ\`djquy #(1;AFPU_};45<&     1D%% &%% &%% &%% &%% &%% , *%% /%% 1%%d 3h 4l 5 4 6 7 7 5 8  P 9T :p 9 /7/= >?< $( 48 DH TXdhtx ( 8 H Xhx    & * 1 5 < @ G K Z ^ m q x |                       , 0 ? C R V eix|#'.29=DHOSZ^mqx| *.6:AEMQX\dhos!%,07;BFMQX\cg   ( 08@HPX`  $(,8 < @ D H L P T X\`dhlptx|/704 1331264894 1002 1002 100644 5204 ` ELF P4(!0% RU$ > $ > $ > : ; I I'  : ;  : ; I8 .: ; '  : ; I  .? : ; ' @: ; I4: ; I 1X Y 11X Y ' II&I5intWZ1@hT'0" I## I$# v%# *# +#- k4 4   &<c< z=> >"Q?(oA)bBaDBdHhL lP T ))-3r bionic/libc/bionicbionic/libc/includelibc_init_static.clibc_init_common.hstdint.h?,EyJrJgJcJRzJIKP??$<'!',($ !! !Y R& R&Y  Y R$ R&Y y r$ R&Y 2D&1&!4 !0 !0! @!`!(  !0 ! @ | $P0X | $P0X0 @T@a @U @V@c @W@`DpblpRpbSb9,__libc_initstructorsslingshot/u/raghu/ics_feb29uintptr_tshort unsigned intenvpinit_arrayfloatunsigned charlong unsigned intonexitlistdtors_arraydoubleunsigned intlong long unsigned int__libc_initargcstructors_array_tlong long intGNU C 4.4.3charshort intctors_arrayargvbionic/libc/bionic/libc_init_static.clong intpreinit_arraysigned charelfdatacall_arrayfini_arrayGCC: (GNU) 4.4.3Agnu.symtab.strtab.shstrtab.text.data.bss.reginfo.rel.pdr.mdebug.abi32.debug_abbrev.rel.debug_info.rel.debug_line.rel.text.__libc_init.rel.debug_frame.rel.eh_frame.rel.debug_loc.rel.debug_pubnames.rel.debug_aranges.rel.debug_ranges.debug_str.comment.gnu.attributes@!@'@,p@9X 5 L>xLpx^p9Z T npj  ~z @ p8 48 Dp Lp" ,p  4p6 Dp0F0 o,  m   ' 3<O\hbionic/libc/bionic/libc_init_static.c__libc_init_gp_disp__libc_init_common__cxa_atexit__libc_finiexit !%3:AHOV]dkry.5 9 = FP U_ dn s}           ,               $ + / > B Q U \ ` o s z ~              wait4.o/ 1365813228 1249825000 100644 1600 ` ELF,P4(<'!$ ! @ ]? bionic/libc/arch-mips/syscalls__wait4.S KKKKKLKK`0bionic/libc/arch-mips/syscalls/__wait4.S/u/raghu/ics_feb29GNU AS 2.21.1%0.symtab.strtab.shstrtab.rel.text.data.bss.reginfo.rel.pdr.rel.debug_line.rel.debug_info.debug_abbrev.rel.debug_aranges@0 %p+p0pp= 9 FpaB Vp dR   bpmtp p 0      0wait4_gp_disp__set_errno  $  L